Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10860 120 / 6e-38 Cytochrome b-c1 complex, subunit 8 protein (.1) AT5G05370 119 / 2e-37 Cytochrome b-c1 complex, subunit 8 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G132000 [exp] 143 / 5e-47 AT5G05370 124 / 3e-39 Cytochrome b-c1 complex, subunit 8 protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034442 [exp] 127 / 1e-40 AT3G10860 115 / 6e-36 Cytochrome b-c1 complex, subunit 8 protein (.1) Lus10019118 [exp] 99 / 3e-29 AT3G10860 96 / 2e-28 Cytochrome b-c1 complex, subunit 8 protein (.1) Lus10021674 [exp] 79 / 2e-21 AT5G05370 75 / 3e-20 Cytochrome b-c1 complex, subunit 8 protein (.1) Lus10035013 [exp] 78 / 4e-21 AT5G05370 75 / 6e-20 Cytochrome b-c1 complex, subunit 8 protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0429 [poplar] [flax] UcrQ-like PF10890 [poplar] [flax] Cyt_b-c1_8 Cytochrome b-c1 complex subunit 8
Representative CDS sequence Show only first row Show all	>Potri.013G159700.1 pacid=42811564 polypeptide=Potri.013G159700.1.p locus=Potri.013G159700 ID=Potri.013G159700.1.v4.1 annot-version=v4.1 ATGGGAAAGCAACCGGTGAGAATGAAGGCGGTGGTGTACGCTCTGTCACCGTTCCAGCAGAAGGTAATGCCTGGTCTATGGAAGGATCTGCCTGGCAAGA TACACCACAAAGTCTCCGAGAACTGGATCAGCGCCACCCTTCTCCTGGGTCCACTCGTCGGCGTCTACACGTATGTGCAAAACTATCAGGAAAAGGAGAA GTTGTCACACAGGTACTGA
AA sequence Show only first row Show all	>Potri.013G159700.1 pacid=42811564 polypeptide=Potri.013G159700.1.p locus=Potri.013G159700 ID=Potri.013G159700.1.v4.1 annot-version=v4.1 MGKQPVRMKAVVYALSPFQQKVMPGLWKDLPGKIHHKVSENWISATLLLGPLVGVYTYVQNYQEKEKLSHRY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G10860			Cytochrome b-c1 complex, subun...		Potri.013G159700 [exp]	0	1
AT5G35620		eIFiso4E, EIF(I...	LOSS OF SUSCEPTIBILITY TO POTY...		Potri.008G171100 [exp]	2.00	0.7413	Pt-EIF(ISO)4E.2
AT1G22520			Domain of unknown function (DU...		Potri.013G105766 [exp]	2.64	0.7988
AT1G04630		MEE4	maternal effect embryo arrest ...		Potri.001G054500 [exp]	5.65	0.7568
AT1G08360			Ribosomal protein L1p/L10e fam...		Potri.004G202766 [exp]	6.32	0.7148
AT1G71260		WHY2, ATWHY2	WHIRLY 2 (.1)		Potri.003G048700 [exp]	6.70	0.7468
AT4G26410			Uncharacterised conserved prot...		Potri.001G001300 [exp]	9.48	0.7285
AT5G60390			GTP binding Elongation factor ...		Potri.010G219500 [exp]	16.73	0.7185
AT3G18030		ATHAL3A	HALOTOLERANCE DETERMINANT 3, A...		Potri.015G089600 [exp]	17.02	0.7397
AT5G22330		ATTIP49A, RIN1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.009G160600 [exp]	18.76	0.6964
AT3G24570			Peroxisomal membrane 22 kDa (M...		Potri.006G242700 [exp]	19.28	0.6470

Compare expression of checked genes

Potri.013G159700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.