Plant FIBer expression Database

Potri.013G162100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00560 76 / 6e-21 ATCG00560.1, PSBL photosystem II reaction center protein L (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02419 PsbL PsbL protein
Representative CDS sequence
>Potri.013G162100.1 pacid=42812511 polypeptide=Potri.013G162100.1.p locus=Potri.013G162100 ID=Potri.013G162100.1.v4.1 annot-version=v4.1
ATGACACAATCAAACCCGAACGAACAAAACGTTGAATTGAATCGTACCAGTCTTTACTGGGGGTTATTACTCATTTTTGTACTTGCTGTTTTATTTTCTA
ATTATTTCTTTAATTAA
AA sequence
>Potri.013G162100.1 pacid=42812511 polypeptide=Potri.013G162100.1.p locus=Potri.013G162100 ID=Potri.013G162100.1.v4.1 annot-version=v4.1
MTQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00560 ATCG00560.1, PS... photosystem II reaction center... Potri.013G162100
[exp]
0 1
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Potri.013G162800
[exp]
2.64 0.9654
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Potri.007G062122
[exp]
3.16 0.9594
ATCG00520 ATCG00520.1, YC... unfolded protein binding (.1) Potri.016G094067
[exp]
4.89 0.9580
ATCG00530 ATCG00530.1, YC... CemA-like proton extrusion pro... Potri.016G094100
[exp]
6.70 0.9546
ATCG00570 ATCG00570.1, PS... photosystem II reaction center... Potri.013G162000
[exp]
8.48 0.9411
ATCG00580 ATCG00580.1, PS... photosystem II reaction center... Potri.013G161900
[exp]
10.00 0.9366
ATCG00520 ATCG00520.1, YC... unfolded protein binding (.1) Potri.013G162400
[exp]
10.81 0.9404
ATCG00510 ATCG00510.1, PS... photsystem I subunit I (.1) Potri.013G162500
[exp]
15.29 0.9206
Potri.007G062061
[exp]
15.55 0.9275
ATCG00500 ATCG00500.1, AC... acetyl-CoA carboxylase carboxy... Potri.013G162600
[exp]
18.33 0.9224

Potri.013G162100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.