Potri.013G162300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00530 338 / 3e-119 ATCG00530.1, YCF10 CemA-like proton extrusion protein-related (.1)
AT4G31040 70 / 1e-13 CemA-like proton extrusion protein-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G094100 411 / 5e-148 ATCG00530 333 / 5e-117 CemA-like proton extrusion protein-related (.1)
Potri.018G150000 73 / 7e-15 AT4G31040 511 / 2e-180 CemA-like proton extrusion protein-related (.1)
Potri.006G080100 68 / 4e-13 AT4G31040 497 / 5e-175 CemA-like proton extrusion protein-related (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021616 67 / 8e-13 AT4G31040 494 / 3e-174 CemA-like proton extrusion protein-related (.1)
Lus10040575 64 / 2e-11 AT4G31040 494 / 1e-172 CemA-like proton extrusion protein-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03040 CemA CemA family
Representative CDS sequence
>Potri.013G162300.1 pacid=42812724 polypeptide=Potri.013G162300.1.p locus=Potri.013G162300 ID=Potri.013G162300.1.v4.1 annot-version=v4.1
ATGGAAAAAAAAGCATTCATTCCCCTTCTATATCTTACGTCTATAGTATTTTTGCCCTGGTGGGTCTCTTTTTCATTTAATAAAAGTCTGGGATCTTGGA
TTATTAATTGGTGGAATACTAGTAAATCCGAAACTTTTTTAAATGATATTCAAGAAAAGAGTATTCTAGAAAAATTAATAGAATTTGAGGAACTCTTCCT
GTTGGACGAAATGATAAAGGAATACCCCGAAACACATCTACAAAAGTTTCGTATCGGAATCCACAAAGAAACGATCCAATTGATCAAGATGCACAACGCA
GATCGTATAGATACGATTTTGCACTTCTCGACAAATATAATCTGTTTCGTTATTCTAAGTGGTTATTCTTTTTTAGTTAATGAAGAACTTTTTATTCTTA
ATTCTTGGGTTCAAGAATTCATATATAACTTAAGCGACACGATAAAAGCCCTTTCTATTCTTTTATTAACCGACTTATGTATAGGATTCCATTCACCCCA
CGGTTGGGAACTAATGATTAGCTCTTTCTACAAGGATTTTGGATTTGCTCATAATGATCAAATTATATCTGGACTTGTTTCCACCTTTCCAGTAATTTTC
GATACAATTTTTAAATATTGGATCTTCCGTTATTTAAATCGTGTATCTCCGTCACTTGTAGTGATTTATCATTCAATGAATGACTGA
AA sequence
>Potri.013G162300.1 pacid=42812724 polypeptide=Potri.013G162300.1.p locus=Potri.013G162300 ID=Potri.013G162300.1.v4.1 annot-version=v4.1
MEKKAFIPLLYLTSIVFLPWWVSFSFNKSLGSWIINWWNTSKSETFLNDIQEKSILEKLIEFEELFLLDEMIKEYPETHLQKFRIGIHKETIQLIKMHNA
DRIDTILHFSTNIICFVILSGYSFLVNEELFILNSWVQEFIYNLSDTIKALSILLLTDLCIGFHSPHGWELMISSFYKDFGFAHNDQIISGLVSTFPVIF
DTIFKYWIFRYLNRVSPSLVVIYHSMND

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00530 ATCG00530.1, YC... CemA-like proton extrusion pro... Potri.013G162300 0 1
ATCG00520 ATCG00520.1, YC... unfolded protein binding (.1) Potri.013G162400 2.00 0.9824
ATCG00530 ATCG00530.1, YC... CemA-like proton extrusion pro... Potri.016G094100 4.24 0.9650
ATCG00270 ATCG00270.1, PS... photosystem II reaction center... Potri.019G047540 4.89 0.9371
ATCG00510 ATCG00510.1, PS... photsystem I subunit I (.1) Potri.013G162500 4.89 0.9549
ATCG00570 ATCG00570.1, PS... photosystem II reaction center... Potri.013G162000 5.29 0.9527
ATCG00270 ATCG00270.1, PS... photosystem II reaction center... Potri.008G207200 5.47 0.9432
ATCG00520 ATCG00520.1, YC... unfolded protein binding (.1) Potri.016G094067 5.91 0.9609
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Potri.013G162800 6.32 0.9614
ATCG00580 ATCG00580.1, PS... photosystem II reaction center... Potri.013G161900 6.32 0.9523
ATCG00380 ATCG00380.1, RP... chloroplast ribosomal protein ... Potri.013G163300 6.63 0.9396

Potri.013G162300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.