Potri.013G162500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00510 67 / 2e-17 ATCG00510.1, PSAI photsystem I subunit I (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G094033 65 / 1e-16 ATCG00510 58 / 1e-13 photsystem I subunit I (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00796 PSI_8 Photosystem I reaction centre subunit VIII
Representative CDS sequence
>Potri.013G162500.1 pacid=42812433 polypeptide=Potri.013G162500.1.p locus=Potri.013G162500 ID=Potri.013G162500.1.v4.1 annot-version=v4.1
ATGACAATTCTCAACAACTTACCCTCTATTTTTGTGCCTTTAGTGGGCTTAGTATTTCCGGCAATTGCAATGGCTTCTTTATCTCTTCATGTTCAAAAAA
ACAAGATTTTTTAG
AA sequence
>Potri.013G162500.1 pacid=42812433 polypeptide=Potri.013G162500.1.p locus=Potri.013G162500 ID=Potri.013G162500.1.v4.1 annot-version=v4.1
MTILNNLPSIFVPLVGLVFPAIAMASLSLHVQKNKIF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00510 ATCG00510.1, PS... photsystem I subunit I (.1) Potri.013G162500 0 1
ATCG00520 ATCG00520.1, YC... unfolded protein binding (.1) Potri.013G162400 3.46 0.9601
ATCG00530 ATCG00530.1, YC... CemA-like proton extrusion pro... Potri.013G162300 4.89 0.9549
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Potri.013G162800 6.00 0.9564
ATCG00520 ATCG00520.1, YC... unfolded protein binding (.1) Potri.016G094067 7.07 0.9518
ATCG00530 ATCG00530.1, YC... CemA-like proton extrusion pro... Potri.016G094100 8.12 0.9491
ATCG00570 ATCG00570.1, PS... photosystem II reaction center... Potri.013G162000 8.77 0.9355
ATCG00580 ATCG00580.1, PS... photosystem II reaction center... Potri.013G161900 9.94 0.9348
ATCG00270 ATCG00270.1, PS... photosystem II reaction center... Potri.019G047540 12.40 0.9177
ATCG00470 ATCG00470.1, AT... ATP synthase epsilon chain (.1... Potri.007G062142 12.96 0.8521
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.007G062202 14.49 0.9037

Potri.013G162500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.