Potri.013G163300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00380 358 / 6e-128 ATCG00380.1, RPS4 chloroplast ribosomal protein S4 (.1)
AT5G39850 44 / 1e-05 Ribosomal protein S4 (.1)
AT5G15200 43 / 4e-05 Ribosomal protein S4 (.1.2)
ATMG00290 42 / 0.0001 ATMG00290.1, RPS4 mitochondrial ribosomal protein S4 (.1)
AT2G07734 42 / 0.0001 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G209801 44 / 5e-06 AT5G15200 200 / 7e-67 Ribosomal protein S4 (.1.2)
Potri.006G209700 45 / 9e-06 AT5G39850 325 / 6e-115 Ribosomal protein S4 (.1)
Potri.018G062300 45 / 9e-06 AT5G39850 332 / 1e-117 Ribosomal protein S4 (.1)
Potri.016G076500 44 / 2e-05 AT5G39850 350 / 1e-124 Ribosomal protein S4 (.1)
Potri.016G076800 44 / 2e-05 AT5G39850 350 / 1e-124 Ribosomal protein S4 (.1)
Potri.011G094500 43 / 5e-05 AT5G39850 336 / 3e-119 Ribosomal protein S4 (.1)
Potri.007G056100 42 / 6e-05 AT5G39850 337 / 1e-119 Ribosomal protein S4 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008624 42 / 8e-05 AT5G15200 342 / 8e-122 Ribosomal protein S4 (.1.2)
Lus10012839 42 / 9e-05 AT5G15200 333 / 4e-118 Ribosomal protein S4 (.1.2)
Lus10030487 42 / 9e-05 AT5G15200 333 / 4e-118 Ribosomal protein S4 (.1.2)
Lus10042193 42 / 0.0003 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0492 S4 PF01479 S4 S4 domain
Representative CDS sequence
>Potri.013G163300.1 pacid=42812494 polypeptide=Potri.013G163300.1.p locus=Potri.013G163300 ID=Potri.013G163300.1.v4.1 annot-version=v4.1
ATGTCACGTTACCGAGGGCCTCGTTTCAAAAAAATACGCCGTCTGGGGGCTTTACCGGGACTAACTAGTAAAAGGCCTAGAGCCGGGAGCGATCTTAGAA
ATCAATCGCGCGCCGGTAAAAAATCTCAATATCGTATTCGTTTAGAAGAAAAACAAAAATTGCGTTTTCATTATGGTCTTACAGAACGACAATTGCTTAA
ATACGTTCGTATCGCCGCAAAAGCCAAAGGGTCAACAGGTCAGGTTTTACTACAATTACTTGAAATGCGTTTGGATAACATCCTTTTTCGATTAGGTATG
GCGTCAACTATTCCTCGAGCCCGCCAATTAGTTAACCATAGACATATTTTAGTTAATGGTCGTATAGTAGATATACCAAGTTATCGCTGCAAACCCCGAG
ATATTATTACAGCGAAGGATGAACAAAAATCTAGAGTTATGATTCAAAATTCTCTTGATTCATTCCCCCAGGAGGAATTGCCAAAACATTTGACTCTTCA
CCCATTCCAATATAAAGGATTGGTCAATCACATAATAGATAGTAAATGGATTGGCTTGAAAATAAATGAATTGTTAGTTGTAGAATATTATTCTCGTCAG
ACTTAA
AA sequence
>Potri.013G163300.1 pacid=42812494 polypeptide=Potri.013G163300.1.p locus=Potri.013G163300 ID=Potri.013G163300.1.v4.1 annot-version=v4.1
MSRYRGPRFKKIRRLGALPGLTSKRPRAGSDLRNQSRAGKKSQYRIRLEEKQKLRFHYGLTERQLLKYVRIAAKAKGSTGQVLLQLLEMRLDNILFRLGM
ASTIPRARQLVNHRHILVNGRIVDIPSYRCKPRDIITAKDEQKSRVMIQNSLDSFPQEELPKHLTLHPFQYKGLVNHIIDSKWIGLKINELLVVEYYSRQ
T

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00380 ATCG00380.1, RP... chloroplast ribosomal protein ... Potri.013G163300 0 1
ATCG01040 ATCG01040.1, YC... Cytochrome C assembly protein ... Potri.001G342966 2.44 0.9258
ATCG00040 ATCG00040.1, MA... maturase K (.1) Potri.013G138201 3.46 0.9449
ATCG00530 ATCG00530.1, YC... CemA-like proton extrusion pro... Potri.013G162300 6.63 0.9396
ATCG01250 ATCG01250.1, ND... NADH-Ubiquinone/plastoquinone ... Potri.011G084251 14.83 0.8997
ATCG00510 ATCG00510.1, PS... photsystem I subunit I (.1) Potri.013G162500 15.42 0.9081
ATCG00080 ATCG00080.1, PS... photosystem II reaction center... Potri.013G138690 16.73 0.8741
ATCG00640 ATCG00640.1, RP... ribosomal protein L33 (.1) Potri.003G067400 17.88 0.8846
ATCG00520 ATCG00520.1, YC... unfolded protein binding (.1) Potri.013G162400 18.65 0.9101
ATCG00570 ATCG00570.1, PS... photosystem II reaction center... Potri.013G162000 18.97 0.9027
ATCG00530 ATCG00530.1, YC... CemA-like proton extrusion pro... Potri.016G094100 19.41 0.9087

Potri.013G163300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.