Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G003600 [exp] 56 / 7e-11 AT3G14470 388 / 2e-115 NB-ARC domain-containing disease resistance protein (.1) Potri.004G170400 [exp] 55 / 2e-10 AT3G14470 401 / 3e-121 NB-ARC domain-containing disease resistance protein (.1) Potri.003G015500 [exp] 53 / 7e-10 AT3G14470 402 / 1e-122 NB-ARC domain-containing disease resistance protein (.1) Potri.014G005400 [exp] 53 / 1e-09 AT3G14460 338 / 1e-95 LRR and NB-ARC domains-containing disease resistance protein (.1) Potri.004G169800 [exp] 50 / 7e-09 AT3G14470 393 / 1e-118 NB-ARC domain-containing disease resistance protein (.1) Potri.004G170232 [exp] 50 / 9e-09 AT3G14470 367 / 1e-108 NB-ARC domain-containing disease resistance protein (.1) Potri.018G135800 [exp] 49 / 3e-08 AT3G14470 403 / 3e-122 NB-ARC domain-containing disease resistance protein (.1) Potri.004G170300 [exp] 49 / 3e-08 AT3G14470 401 / 3e-123 NB-ARC domain-containing disease resistance protein (.1) Potri.014G005600 [exp] 48 / 4e-08 AT3G14470 362 / 3e-107 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.014G003175.1 pacid=42764793 polypeptide=Potri.014G003175.1.p locus=Potri.014G003175 ID=Potri.014G003175.1.v4.1 annot-version=v4.1 ATGCAGCAGACGACGAAAGGTCTAGCAATATCATTAGAGCTTTTGCAGCTGGCCTTCCAATCCCCAAGCAAGTCCAATCCTTTCAGTAGCCATGGAACTC ACCCTTGTCAAAGTCTTCTCCAAGGCAAACATGTAAGTTCAAGAACATGGATCGTCATGTTGAGACAAACCCATAGGACCAAATCTCAGGCAAAAGAAAG TTACAGCAAAGAATAA
AA sequence Show only first row Show all	>Potri.014G003175.1 pacid=42764793 polypeptide=Potri.014G003175.1.p locus=Potri.014G003175 ID=Potri.014G003175.1.v4.1 annot-version=v4.1 MQQTTKGLAISLELLQLAFQSPSKSNPFSSHGTHPCQSLLQGKHVSSRTWIVMLRQTHRTKSQAKESYSKE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.014G003175 [exp]	0	1
AT5G45540			Protein of unknown function (D...		Potri.015G114900 [exp]	5.00	0.7853
					Potri.013G094050 [exp]	7.21	0.7466
AT4G36490		ATSFH12	SEC14-like 12 (.1)		Potri.005G119700 [exp]	8.00	0.7339
AT2G35550	BBR_BPC	BPC7, BBR/BPC7,...	basic pentacysteine 7 (.1.2.3....		Potri.001G133900 [exp]	21.00	0.7296
AT5G65550			UDP-Glycosyltransferase superf...		Potri.008G024801 [exp]	24.00	0.7134
					Potri.006G120901 [exp]	28.03	0.7408
AT3G22520			unknown protein		Potri.010G086700 [exp]	33.16	0.7268
AT4G06536			SPla/RYanodine receptor (SPRY)...		Potri.002G123800 [exp]	36.87	0.6964
AT2G33170			Leucine-rich repeat receptor-l...		Potri.003G174900 [exp]	37.96	0.7159
AT2G23260		UGT84B1	UDP-glucosyl transferase 84B1 ...		Potri.009G095200 [exp]	39.11	0.6748

Compare expression of checked genes

Potri.014G003175 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.