Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14470 92 / 9e-22 NB-ARC domain-containing disease resistance protein (.1) AT3G14460 84 / 6e-19 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G58602 45 / 2e-05 LRR and NB-ARC domains-containing disease resistance protein (.1.2) AT1G59218 40 / 0.0005 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) AT1G58848 40 / 0.0005 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G002900 [exp] 337 / 3e-108 AT3G14470 397 / 2e-119 NB-ARC domain-containing disease resistance protein (.1) Potri.014G003832 [exp] 313 / 2e-99 AT3G14470 370 / 1e-109 NB-ARC domain-containing disease resistance protein (.1) Potri.004G169800 [exp] 303 / 2e-96 AT3G14470 393 / 1e-118 NB-ARC domain-containing disease resistance protein (.1) Potri.014G012000 [exp] 295 / 2e-93 AT3G14470 367 / 7e-109 NB-ARC domain-containing disease resistance protein (.1) Potri.004G170700 [exp] 295 / 4e-93 AT3G14470 409 / 3e-124 NB-ARC domain-containing disease resistance protein (.1) Potri.014G007600 [exp] 294 / 5e-93 AT3G14470 381 / 3e-114 NB-ARC domain-containing disease resistance protein (.1) Potri.004G170300 [exp] 289 / 4e-92 AT3G14470 401 / 3e-123 NB-ARC domain-containing disease resistance protein (.1) Potri.003G015500 [exp] 290 / 6e-92 AT3G14470 402 / 1e-122 NB-ARC domain-containing disease resistance protein (.1) Potri.014G005600 [exp] 281 / 3e-88 AT3G14470 362 / 3e-107 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007261 [exp] 95 / 2e-22 AT3G14460 654 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10026109 [exp] 92 / 3e-21 AT3G14470 598 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Lus10039509 [exp] 91 / 3e-21 AT3G14460 613 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10024173 [exp] 91 / 4e-21 AT3G14460 681 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10039540 [exp] 90 / 8e-21 AT3G14470 727 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Lus10016316 [exp] 89 / 1e-20 AT3G14470 494 / 6e-156 NB-ARC domain-containing disease resistance protein (.1) Lus10005321 [exp] 88 / 5e-20 AT3G14460 607 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10039548 [exp] 87 / 8e-20 AT3G14460 164 / 6e-44 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10008584 [exp] 81 / 1e-17 AT3G14470 186 / 2e-49 NB-ARC domain-containing disease resistance protein (.1) Lus10005218 [exp] 76 / 6e-16 AT3G14470 379 / 2e-113 NB-ARC domain-containing disease resistance protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.014G003401.1 pacid=42762927 polypeptide=Potri.014G003401.1.p locus=Potri.014G003401 ID=Potri.014G003401.1.v4.1 annot-version=v4.1 ATGGTGCCAGCTGAGGTGAGACTCTTAACACGCCTTCAAACTCTGCCTTTTTTTGTTGTGGGTCCAAATCATAAAATTGAAGAGCTGGGATGTTTGAATG AACTAAGAGGAGCATTGAAGATATCCAAGCTTGAACAAGTTAGAGACAGAGAAGAAGCTGAAAAGGCAAAATTGCGTGAAAAAAGAATGAACAAATTGGT GCTTAAATGGAGTGATGATGAAGGTAACAACAGTGTTAACAGTGAGGATGCGGTGGAAGGCCTGCAACCTCACCCAGACATAAAAAGCTTGAAAATTAAG GGTTACGGTGATGAATATTTCCCATCATGGATGTCTGCATTGCCGCTCAATAATCTGACGGTCCTGAGATTGAAAGACTGCAGCAAGTGCAGACAACTCC CAACACTTGGATGTCTTCCTCGCCTTAAGATTATAGAGATTAAAGGAATGAGTACTATAAAATGTATAGGCAATGAGTTCTATAGCAGTGGCAGTGCAGC AGTATTGTTTCCAGCACTAAAAGAACTCTCTCTAAACAGTATTGGAGGTCTTGAAGAATGGATAGTATCAGGTGGAGAAGTTGTTGCAGTATTTCCCTGT CTTGAATAG
AA sequence Show only first row Show all	>Potri.014G003401.1 pacid=42762927 polypeptide=Potri.014G003401.1.p locus=Potri.014G003401 ID=Potri.014G003401.1.v4.1 annot-version=v4.1 MVPAEVRLLTRLQTLPFFVVGPNHKIEELGCLNELRGALKISKLEQVRDREEAEKAKLREKRMNKLVLKWSDDEGNNSVNSEDAVEGLQPHPDIKSLKIK GYGDEYFPSWMSALPLNNLTVLRLKDCSKCRQLPTLGCLPRLKIIEIKGMSTIKCIGNEFYSSGSAAVLFPALKELSLNSIGGLEEWIVSGGEVVAVFPC LE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G14470			NB-ARC domain-containing disea...		Potri.014G003401 [exp]	0	1
AT3G14470			NB-ARC domain-containing disea...		Potri.014G002900 [exp]	2.44	0.9170
AT3G14470			NB-ARC domain-containing disea...		Potri.004G170400 [exp]	2.82	0.9201
AT4G19050			NB-ARC domain-containing disea...		Potri.004G170392 [exp]	2.82	0.8895
AT3G14470			NB-ARC domain-containing disea...		Potri.014G003832 [exp]	4.47	0.8860
AT3G14470			NB-ARC domain-containing disea...		Potri.014G003600 [exp]	7.93	0.8675
AT3G14470			NB-ARC domain-containing disea...		Potri.012G121851 [exp]	15.71	0.8270
AT4G27220			NB-ARC domain-containing disea...		Potri.001G425500 [exp]	19.49	0.7966
AT3G59580		NLP9	Plant regulator RWP-RK family ...		Potri.017G021330 [exp]	20.14	0.8204
AT3G04940		ATCYSD1	cysteine synthase D1 (.1)		Potri.005G048066 [exp]	20.24	0.7299
AT3G14470			NB-ARC domain-containing disea...		Potri.012G123200 [exp]	21.79	0.7759

Compare expression of checked genes

Potri.014G003401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.