Potri.014G003501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.014G003501.1 pacid=42764607 polypeptide=Potri.014G003501.1.p locus=Potri.014G003501 ID=Potri.014G003501.1.v4.1 annot-version=v4.1
ATGCAGAATAGTGTTTGTCAGCCTGCCCATTGGATTATCGGATCAGATTCAACAAGCGATGTTCCATGGCTTGAGAAGAACAGGGAAAGCAGGTCGTGGA
GAATGCAGAACATCTTCAACTCCATCAGCAAGTTGAAAAGGGTAACAAAAATTTGGCGGCAGGTACTGTAG
AA sequence
>Potri.014G003501.1 pacid=42764607 polypeptide=Potri.014G003501.1.p locus=Potri.014G003501 ID=Potri.014G003501.1.v4.1 annot-version=v4.1
MQNSVCQPAHWIIGSDSTSDVPWLEKNRESRSWRMQNIFNSISKLKRVTKIWRQVL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.014G003501 0 1
AT5G59480 Haloacid dehalogenase-like hyd... Potri.009G033500 1.00 0.8158
AT5G15110 Pectate lyase family protein (... Potri.015G064700 3.74 0.7448
Potri.004G018900 6.70 0.7382
AT3G19620 Glycosyl hydrolase family prot... Potri.007G114300 8.12 0.7124
AT5G67500 VDAC2, ATVDAC2 ARABIDOPSIS THALIANA VOLTAGE D... Potri.009G088466 10.58 0.6883
AT5G20710 BGAL7 beta-galactosidase 7 (.1) Potri.001G025800 16.97 0.6977
Potri.019G014366 27.11 0.7145
Potri.010G221301 32.83 0.6935
AT5G44440 FAD-binding Berberine family p... Potri.011G162800 49.30 0.6941
AT5G36930 Disease resistance protein (TI... Potri.003G084333 63.98 0.6769

Potri.014G003501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.