Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G50410 152 / 3e-44 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1) AT3G20010 148 / 8e-43 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1) AT1G61140 145 / 8e-42 EDA16 embryo sac development arrest 16, SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1.2.3) AT1G11100 140 / 4e-40 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1.2) AT3G16600 97 / 4e-25 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1) AT5G22750 91 / 6e-23 RAD5A, RAD5 DNA/RNA helicase protein (.1) AT5G43530 89 / 5e-22 Helicase protein with RING/U-box domain (.1) AT1G05120 86 / 5e-21 Helicase protein with RING/U-box domain (.1) AT1G02670 85 / 1e-20 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G12810 77 / 7e-18 CHR13, SRCAP, PIE1 PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1, SNF2 domain-containing protein / helicase domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G000700 [exp] 180 / 4e-54 AT1G50410 1083 / 0.0 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1) Potri.011G046400 [exp] 145 / 1e-41 AT1G61140 958 / 0.0 embryo sac development arrest 16, SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1.2.3) Potri.004G037700 [exp] 140 / 2e-40 AT1G61140 1007 / 0.0 embryo sac development arrest 16, SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1.2.3) Potri.004G189400 [exp] 92 / 2e-23 AT5G22750 1506 / 0.0 DNA/RNA helicase protein (.1) Potri.014G154600 [exp] 90 / 2e-22 AT1G05120 1058 / 0.0 Helicase protein with RING/U-box domain (.1) Potri.003G083400 [exp] 90 / 2e-22 AT5G43530 1342 / 0.0 Helicase protein with RING/U-box domain (.1) Potri.001G207700 [exp] 81 / 4e-19 AT3G12810 2199 / 0.0 PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1, SNF2 domain-containing protein / helicase domain-containing protein (.1) Potri.010G099000 [exp] 78 / 2e-18 AT2G02090 1061 / 0.0 CHROMATIN REMODELING 19, SNF2 domain-containing protein / helicase domain-containing protein (.1) Potri.003G022100 [exp] 78 / 2e-18 AT3G12810 1824 / 0.0 PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1, SNF2 domain-containing protein / helicase domain-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041008 [exp] 156 / 1e-45 AT1G50410 1060 / 0.0 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1) Lus10013452 [exp] 155 / 2e-45 AT1G50410 1003 / 0.0 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1) Lus10011211 [exp] 147 / 2e-42 AT1G61140 959 / 0.0 embryo sac development arrest 16, SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1.2.3) Lus10018465 [exp] 146 / 4e-42 AT1G61140 546 / 2e-175 embryo sac development arrest 16, SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related (.1.2.3) Lus10043365 [exp] 95 / 3e-24 AT5G22750 1445 / 0.0 DNA/RNA helicase protein (.1) Lus10041156 [exp] 87 / 3e-21 AT5G43530 1222 / 0.0 Helicase protein with RING/U-box domain (.1) Lus10030044 [exp] 85 / 1e-20 AT1G05120 1047 / 0.0 Helicase protein with RING/U-box domain (.1) Lus10002974 [exp] 79 / 1e-18 AT3G12810 1071 / 0.0 PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1, SNF2 domain-containing protein / helicase domain-containing protein (.1) Lus10027296 [exp] 77 / 4e-18 AT5G05130 470 / 1e-159 DNA/RNA helicase protein (.1) Lus10039140 [exp] 78 / 5e-18 AT2G02090 1107 / 0.0 CHROMATIN REMODELING 19, SNF2 domain-containing protein / helicase domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00271 [poplar] [flax] Helicase_C Helicase conserved C-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.014G005701.1 pacid=42764733 polypeptide=Potri.014G005701.1.p locus=Potri.014G005701 ID=Potri.014G005701.1.v4.1 annot-version=v4.1 ATGTTGGATTTGGTTGAAATTTCACTGAATCAGTATTGCATCCAGTATAGAAGGCTTGACGGGACACTGACTTTGAGTTCAAGAGACAGGGCTGTTAAAG ATTTGAACACTGATCCCAAGGTCACTGTGATGCTAACGTCCTTAAAGGCAGGAAACCTTGGTTTGAACATGATTGCTGCATGTCATGAAATCCTTCTGGA TCTTTGGTGGAATCCAACCACTAAGGATCAGGCTATTGATCGAGCTCATAGAATTGCACAGACTCGTCCTGTTACAGTAACATGA
AA sequence Show only first row Show all	>Potri.014G005701.1 pacid=42764733 polypeptide=Potri.014G005701.1.p locus=Potri.014G005701 ID=Potri.014G005701.1.v4.1 annot-version=v4.1 MLDLVEISLNQYCIQYRRLDGTLTLSSRDRAVKDLNTDPKVTVMLTSLKAGNLGLNMIAACHEILLDLWWNPTTKDQAIDRAHRIAQTRPVTVT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G50410			SNF2 domain-containing protein...		Potri.014G005701 [exp]	0	1
AT3G14610		CYP72A7	"cytochrome P450, family 72, s...		Potri.005G126600 [exp]	1.41	0.9653
					Potri.004G170350 [exp]	2.00	0.9351
AT5G26594		ARR24	response regulator 24 (.1)		Potri.001G051000 [exp]	3.46	0.9086
AT1G15200			protein-protein interaction re...		Potri.001G208200 [exp]	4.24	0.9322
AT2G02250		ATPP2-B2	phloem protein 2-B2 (.1)		Potri.018G016000 [exp]	4.24	0.9485
AT1G33500			unknown protein		Potri.013G095400 [exp]	8.30	0.8954
					Potri.014G003451 [exp]	9.00	0.9250
AT1G05160		ATKAO1, CYP88A3	ENT-KAURENOIC ACID OXYDASE 1, ...		Potri.013G161800 [exp]	12.44	0.8885	Pt-KAO2.1,CYP88A8
					Potri.017G020864 [exp]	12.96	0.9070
AT5G63700			zinc ion binding;DNA binding (...		Potri.011G078050 [exp]	13.11	0.8796

Compare expression of checked genes

Potri.014G005701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.