Potri.014G006300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G58420 56 / 3e-10 Uncharacterised conserved protein UCP031279 (.1)
AT5G65925 54 / 2e-09 unknown protein
AT4G37700 53 / 3e-09 unknown protein
AT1G10140 47 / 4e-07 Uncharacterised conserved protein UCP031279 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G006100 189 / 2e-62 AT1G58420 68 / 1e-14 Uncharacterised conserved protein UCP031279 (.1)
Potri.014G014600 93 / 2e-24 AT1G58420 87 / 4e-22 Uncharacterised conserved protein UCP031279 (.1)
Potri.002G117100 89 / 4e-23 AT1G58420 84 / 1e-20 Uncharacterised conserved protein UCP031279 (.1)
Potri.014G014500 76 / 6e-18 AT1G58420 81 / 9e-20 Uncharacterised conserved protein UCP031279 (.1)
Potri.009G085900 74 / 5e-17 ND /
Potri.009G086000 74 / 6e-17 ND /
Potri.001G290300 67 / 5e-14 ND /
Potri.001G290400 51 / 2e-08 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025207 77 / 4e-18 AT4G37700 56 / 4e-10 unknown protein
Lus10011553 72 / 1e-16 ND 49 / 4e-08
Lus10011707 58 / 8e-11 AT4G37700 45 / 2e-06 unknown protein
Lus10018665 50 / 6e-08 AT1G10140 89 / 2e-22 Uncharacterised conserved protein UCP031279 (.1)
Lus10012496 49 / 2e-07 AT1G58420 86 / 4e-21 Uncharacterised conserved protein UCP031279 (.1)
Lus10007729 44 / 8e-06 AT1G10140 82 / 1e-19 Uncharacterised conserved protein UCP031279 (.1)
PFAM info
Representative CDS sequence
>Potri.014G006300.1 pacid=42764156 polypeptide=Potri.014G006300.1.p locus=Potri.014G006300 ID=Potri.014G006300.1.v4.1 annot-version=v4.1
ATGGTTATCAATAAGAAGTCCAGGAAAGAAAGCACACTAAAAAAGATTCTGAAGGCACCCCTTAGGATTTTGGCCAGGGCCAGGGACTTCTACATTAAGG
GAATGGCTGAATACTCAGATCAGGTCTGTGTGATGAGTTGCCCAACAGGCAATTTCAATACCATGCCTCGAAGTTACAGTGTCAGCTCAACAAAACCAAA
CCACTTGGATGATGATCGTAGGGAGCCTTTAAGGGCTGCCTCCACCAGGAGTAATTTAGGAAGTAGAAACAGCAAGATCAATGTGGATGTTCCTGCAAGA
CAACAATATAGTCATAAGAAATCTGCAACTCGACTAGGAGACAATATGCCTAGGAGTCATACTGTTGCTATTGGAAGGATTGATGAAGAAAAACCATGTG
ATTTTGATGAAGAGGATGTCAAGGTTAAGACCAATGTTTATCCCAGAAGCAGAAGCTATGCTGTCTCTAAAAGGTGA
AA sequence
>Potri.014G006300.1 pacid=42764156 polypeptide=Potri.014G006300.1.p locus=Potri.014G006300 ID=Potri.014G006300.1.v4.1 annot-version=v4.1
MVINKKSRKESTLKKILKAPLRILARARDFYIKGMAEYSDQVCVMSCPTGNFNTMPRSYSVSSTKPNHLDDDRREPLRAASTRSNLGSRNSKINVDVPAR
QQYSHKKSATRLGDNMPRSHTVAIGRIDEEKPCDFDEEDVKVKTNVYPRSRSYAVSKR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G58420 Uncharacterised conserved prot... Potri.014G006300 0 1
AT3G12910 NAC NAC (No Apical Meristem) domai... Potri.007G066300 5.83 0.9054
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Potri.008G205200 12.12 0.8812 Pt-IFS1.42
AT1G42960 unknown protein Potri.005G099233 12.72 0.8398
AT5G65600 Concanavalin A-like lectin pro... Potri.016G031300 12.96 0.8097 Pt-LEC.3
AT3G50930 BCS1 cytochrome BC1 synthesis (.1) Potri.007G020900 13.22 0.8744
AT2G31180 MYB ATMYB14, Myb14a... ARABIDOPSIS THALIANA MYB DOMAI... Potri.019G018200 13.85 0.8791
AT1G61105 Toll-Interleukin-Resistance (T... Potri.004G038200 17.17 0.7641
AT1G76430 PHT1;9 phosphate transporter 1;9 (.1) Potri.005G256100 18.43 0.8787 11
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Potri.006G268400 19.44 0.8780
AT3G27970 Exonuclease family protein (.1... Potri.017G073300 20.97 0.8227

Potri.014G006300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.