Potri.014G006400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G37710 40 / 0.0002 VQ motif-containing protein (.1)
AT2G22880 39 / 0.0005 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G006200 204 / 3e-67 AT4G37710 / VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011555 48 / 5e-07 AT4G37710 47 / 2e-07 VQ motif-containing protein (.1)
Lus10019270 45 / 7e-06 AT4G37710 47 / 4e-07 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.014G006400.2 pacid=42763127 polypeptide=Potri.014G006400.2.p locus=Potri.014G006400 ID=Potri.014G006400.2.v4.1 annot-version=v4.1
ATGGAAACATATAATTCTTCTTCTTCTTCTTCTTTGACATCATCATCAATGTACTCGAAGCAATTCTCAGAAGAAACAAAGGGCTTGAAAATGCCACAAT
CTTACCATTCATCACTTCATTCAATCCGGAGAACCCAGATGAAACCATGGAAGAAACCAATAGCACCATTGCCACCAACCCCACCAAGAGTTTACAAGGT
GGATCCTATAAACTTCCGAGACCTTGTTCAGAAGCTCACTGGTGCACCCAAGAAAGAGCCAGAGCCAGAGCCGCAGTCAAGGCTACAAAGCGTGGCACCT
CCTCCACTTGATCTCTTTACACCAACATTATTTGGTAGAGAAAGAGAGATCGCAGCAGTACCCTTACAGCTCCTTCCTTCGCCCGCACAAACCCCACTGT
CTGCCAGCTTGTACCAGGAGTTGATGTATGAATCATTGGATGCAAAACCCGAGAGGATGCCAGAAAGTATAATGTCTGTATCAAGTTCCCTCGAATTGAA
TCTGTCACCATCTTATCATGCTTGGTGTTCCTATCCTCTTCTGAGCCCAGGAACTCTTTCCAGTCTTGAGCAAGGCACCGTGCTTTAG
AA sequence
>Potri.014G006400.2 pacid=42763127 polypeptide=Potri.014G006400.2.p locus=Potri.014G006400 ID=Potri.014G006400.2.v4.1 annot-version=v4.1
METYNSSSSSSLTSSSMYSKQFSEETKGLKMPQSYHSSLHSIRRTQMKPWKKPIAPLPPTPPRVYKVDPINFRDLVQKLTGAPKKEPEPEPQSRLQSVAP
PPLDLFTPTLFGREREIAAVPLQLLPSPAQTPLSASLYQELMYESLDAKPERMPESIMSVSSSLELNLSPSYHAWCSYPLLSPGTLSSLEQGTVL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G37710 VQ motif-containing protein (.... Potri.014G006400 0 1
AT1G28130 GH3.17 Auxin-responsive GH3 family pr... Potri.001G069000 1.00 0.9767 7
AT3G13790 ATCWINV1, ATBFR... ARABIDOPSIS THALIANA CELL WALL... Potri.006G227400 5.47 0.9594 Pt-CWINV.1
AT5G12380 ANNAT8 annexin 8 (.1) Potri.003G200700 7.74 0.9373 ANN1.1
AT2G35770 SCPL28 serine carboxypeptidase-like 2... Potri.008G041700 7.93 0.9303
AT4G35160 O-methyltransferase family pro... Potri.004G050500 8.48 0.9354 FOMT1,OOMT2.17
AT1G65870 Disease resistance-responsive ... Potri.016G060700 11.61 0.9357
AT2G30210 LAC3 laccase 3 (.1) Potri.013G152700 11.95 0.9289
Potri.016G124800 13.49 0.8755
AT1G78780 pathogenesis-related family pr... Potri.001G389400 17.32 0.9204
AT5G66816 unknown protein Potri.005G136800 18.65 0.8494

Potri.014G006400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.