Potri.014G006501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22870 199 / 2e-65 EMB2001 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G11480 122 / 4e-35 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G006300 218 / 7e-73 AT2G22870 434 / 2e-154 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.006G243200 140 / 5e-42 AT5G11480 422 / 2e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.018G037000 129 / 7e-38 AT5G11480 421 / 7e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011703 203 / 8e-67 AT2G22870 427 / 5e-152 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10039653 195 / 2e-63 AT2G22870 426 / 2e-151 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10022126 129 / 1e-37 AT5G11480 418 / 8e-148 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10011673 127 / 6e-37 AT5G11480 418 / 1e-147 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.014G006501.2 pacid=42763678 polypeptide=Potri.014G006501.2.p locus=Potri.014G006501 ID=Potri.014G006501.2.v4.1 annot-version=v4.1
ATGGATTGGTCCTCCTTTACAAAAGGGTACTTTTTGAACAGAGAAGCTCTGGTAGCTGTCCTACTTCTCATTGATGCTAGTGTCCTGCCTCAAAAGATTG
ACTTGGATTGTGCTAACTGGCTTGGACGCAACAATATACCAATGACTTTTGTTTTCACAAAGTGTGACAAAATGAAGGGGGGAAAGGGAATAAGGCGTGT
TGAGAATATCAGGAATTTTCAGGAGTTGATCAGGCAAAACTATCAGCAACATCCTGCATGGATCATGACTAGTATTGTCATTGGTTTGGGCAGAGATGAG
CTTCTCCTACACATGTCCCAGCTAAGAAACTACTGGGATCAGTAA
AA sequence
>Potri.014G006501.2 pacid=42763678 polypeptide=Potri.014G006501.2.p locus=Potri.014G006501 ID=Potri.014G006501.2.v4.1 annot-version=v4.1
MDWSSFTKGYFLNREALVAVLLLIDASVLPQKIDLDCANWLGRNNIPMTFVFTKCDKMKGGKGIRRVENIRNFQELIRQNYQQHPAWIMTSIVIGLGRDE
LLLHMSQLRNYWDQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G22870 EMB2001 embryo defective 2001, P-loop ... Potri.014G006501 0 1
AT2G18465 Chaperone DnaJ-domain superfam... Potri.001G308900 9.94 0.5804
AT5G59460 scarecrow-like transcription f... Potri.009G033400 14.00 0.5104
AT4G20280 TAF11 TBP-associated factor 11 (.1) Potri.003G157450 52.82 0.5075
AT5G64010 unknown protein Potri.005G064951 64.66 0.5055
AT1G76820 eukaryotic translation initiat... Potri.011G132100 68.81 0.4682

Potri.014G006501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.