Plant FIBer expression Database

Pt-PSK3.2 (Potri.014G006900) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-PSK3.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22860 52 / 2e-10 ATPSK2 phytosulfokine 2 precursor (.1)
AT3G49780 51 / 7e-10 ATPSK3(FORMERSYMBOL), ATPSK3(FORMERSYMBOL), ATPSK4, ATPSK3(FORMERSYMBOL), ATPSK3(FORMERSYMBOL), ATP phytosulfokine 4 precursor (.1)
AT4G37720 46 / 4e-08 ATPSK6, ATPSK4 phytosulfokine 6 precursor (.1)
AT5G65870 44 / 2e-07 ATPSK5 phytosulfokine 5 precursor (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G006800
[exp]
92 / 2e-26 AT3G49780 60 / 1e-13 phytosulfokine 4 precursor (.1)
Potri.002G116300
[exp]
49 / 2e-09 AT2G22860 50 / 5e-10 phytosulfokine 2 precursor (.1)
Potri.014G014000
[exp]
49 / 5e-09 AT3G49780 69 / 2e-17 phytosulfokine 4 precursor (.1)
Potri.009G085600
[exp]
42 / 1e-06 AT3G49780 68 / 1e-16 phytosulfokine 4 precursor (.1)
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06404 PSK Phytosulfokine precursor protein (PSK)
Representative CDS sequence
>Potri.014G006900.3 pacid=42763136 polypeptide=Potri.014G006900.3.p locus=Potri.014G006900 ID=Potri.014G006900.3.v4.1 annot-version=v4.1
ATGGCCAGTGTTGTTAAGGTTGCCACACTCTTCTTGGTAGCCCTCCTCCTCTGCTCCACAATAACCTATGCCGCCCGCCCTGAGCCAGGCTTTCCTGGTG
GTTCTTTGGCAAAGAACCAACATAAGGTTGTTGAGGCCGAGCATGCAGAGGTAATGGAAGAGATCAGCTGTGAAGGGCTTGGTGAGGAAGAGTGCTTGAT
GAGAAGGACACTTGCTGCTCACACCGATTACATCTATACCCAGAAGAACAATCCATGA
AA sequence
>Potri.014G006900.3 pacid=42763136 polypeptide=Potri.014G006900.3.p locus=Potri.014G006900 ID=Potri.014G006900.3.v4.1 annot-version=v4.1
MASVVKVATLFLVALLLCSTITYAARPEPGFPGGSLAKNQHKVVEAEHAEVMEEISCEGLGEEECLMRRTLAAHTDYIYTQKNNP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G22860 ATPSK2 phytosulfokine 2 precursor (.1... Potri.014G006900
[exp]
0 1 Pt-PSK3.2
Potri.010G144600
[exp]
1.41 0.9075
AT4G24210 SLY1 SLEEPY1, F-box family protein ... Potri.014G022100
[exp]
1.41 0.9058
AT1G28310 DOF AtDof1. 4 Dof-type zinc finger DNA-bindi... Potri.004G046600
[exp]
6.00 0.8709
AT4G05320 UBQ10 polyubiquitin 10 (.1.2.3.4.5.6... Potri.017G036800
[exp]
8.48 0.8334 UBQ11.2
AT5G50740 Heavy metal transport/detoxifi... Potri.006G006100
[exp]
10.95 0.8621
AT4G39700 Heavy metal transport/detoxifi... Potri.010G005300
[exp]
12.84 0.8625
AT4G35160 O-methyltransferase family pro... Potri.013G121300
[exp]
14.59 0.8164 OOMT2.16
AT1G69588 CLE45 CLAVATA3/ESR-RELATED 45 (.1) Potri.010G169300
[exp]
14.69 0.8490
AT1G11120 unknown protein Potri.011G045900
[exp]
14.83 0.8212
AT3G47500 DOF CDF3, AtDof3,3 cycling DOF factor 3 (.1) Potri.010G167600
[exp]
14.86 0.8540

Potri.014G006900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.