Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G22870 130 / 5e-39 EMB2001 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G11480 97 / 6e-26 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G58370 51 / 8e-09 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G006300 [exp] 136 / 3e-41 AT2G22870 434 / 2e-154 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.006G243200 [exp] 100 / 3e-27 AT5G11480 422 / 2e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.018G037000 [exp] 99 / 9e-27 AT5G11480 421 / 7e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.019G128000 [exp] 47 / 1e-07 AT5G58370 461 / 1e-158 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039653 [exp] 133 / 7e-40 AT2G22870 426 / 2e-151 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10011703 [exp] 130 / 5e-39 AT2G22870 427 / 5e-152 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10022126 [exp] 97 / 1e-25 AT5G11480 418 / 8e-148 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10011673 [exp] 97 / 1e-25 AT5G11480 418 / 1e-147 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10009919 [exp] 49 / 3e-08 AT5G58370 473 / 9e-165 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF01926 [poplar] [flax] MMR_HSR1 50S ribosome-binding GTPase
Representative CDS sequence Show only first row Show all	>Potri.014G007450.1 pacid=42764810 polypeptide=Potri.014G007450.1.p locus=Potri.014G007450 ID=Potri.014G007450.1.v4.1 annot-version=v4.1 ATGATCTTGCCTGGCTCGAATATTGTTGTGGGACCATATGCGGGTCATGCCCATATCAAGGAAGTTGAGTTTGTTAAGAGTAGGGGGGCGGCTAAGTACT GTCCGAGAGACGAGCTATCCGAGTTTGCAATTTTGGGTCGGTCCAACGTGGGGAAGTCTTCACTTATCAATGCTTTTGTCAGAAAGAAAGAAGTTGCTCT CACTTCTAAGAAACCAGAGAAGATTCAGTTGATAAATCATTTTTGGTGA
AA sequence Show only first row Show all	>Potri.014G007450.1 pacid=42764810 polypeptide=Potri.014G007450.1.p locus=Potri.014G007450 ID=Potri.014G007450.1.v4.1 annot-version=v4.1 MILPGSNIVVGPYAGHAHIKEVEFVKSRGAAKYCPRDELSEFAILGRSNVGKSSLINAFVRKKEVALTSKKPEKIQLINHFW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G22870		EMB2001	embryo defective 2001, P-loop ...		Potri.014G007450 [exp]	0	1
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Potri.005G038400 [exp]	2.82	0.8480
AT2G19520		ATMSI4, ACG1, N...	MULTICOPY SUPPRESSOR OF IRA1 4...		Potri.006G151800 [exp]	6.70	0.7805	NFC905,ATMSI4.4
AT1G25472		CPuORF54	conserved peptide upstream ope...		Potri.010G125700 [exp]	10.19	0.7976
AT5G03800		EMB166, EMB175,...	embryo defective 1899, EMBRYO ...		Potri.016G096400 [exp]	12.48	0.7988
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Potri.005G050300 [exp]	16.61	0.7850
AT1G71210			Pentatricopeptide repeat (PPR)...		Potri.004G229100 [exp]	21.90	0.7823
AT5G61390			Polynucleotidyl transferase, r...		Potri.015G062000 [exp]	28.28	0.7594
AT2G41140		CRK1, ATCRK1, A...	CDPK-related kinase 1 (.1)		Potri.006G040500 [exp]	31.43	0.7576	CRK1.1
AT1G14850		NUP155	nucleoporin 155 (.1)		Potri.008G134800 [exp]	32.15	0.7755
AT4G38180	FAR1_related	FRS5	FAR1-related sequence 5 (.1)		Potri.011G145800 [exp]	37.50	0.7513

Compare expression of checked genes

Potri.014G007450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.