Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59845 99 / 7e-29 Gibberellin-regulated family protein (.1) AT2G39540 96 / 1e-27 Gibberellin-regulated family protein (.1) AT2G14900 95 / 5e-27 Gibberellin-regulated family protein (.1) AT1G10588 89 / 8e-25 Gibberellin-regulated family protein (.1.2) AT1G74670 66 / 2e-15 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT5G15230 62 / 5e-14 GASA4 GAST1 protein homolog 4 (.1.2) AT4G09600 60 / 2e-13 GASA3 GAST1 protein homolog 3 (.1) AT1G22690 59 / 1e-12 Gibberellin-regulated family protein (.1.2.3) AT3G02885 57 / 3e-12 GASA5 GAST1 protein homolog 5 (.1) AT2G18420 56 / 1e-11 Gibberellin-regulated family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G297700 [exp] 118 / 2e-36 AT2G14900 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.009G092600 [exp] 114 / 6e-35 AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.001G315500 [exp] 79 / 6e-21 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1) Potri.007G051300 [exp] 71 / 2e-17 AT2G14900 61 / 3e-13 Gibberellin-regulated family protein (.1) Potri.006G044400 [exp] 70 / 5e-17 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.001G254100 [exp] 70 / 5e-17 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.013G113400 [exp] 66 / 1e-15 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.017G124200 [exp] 65 / 2e-15 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1) Potri.005G239000 [exp] 61 / 7e-14 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024791 [exp] 116 / 8e-36 AT5G59845 114 / 5e-35 Gibberellin-regulated family protein (.1) Lus10018708 [exp] 110 / 3e-33 AT5G59845 114 / 8e-35 Gibberellin-regulated family protein (.1) Lus10001407 [exp] 97 / 1e-27 AT5G59845 95 / 6e-27 Gibberellin-regulated family protein (.1) Lus10042012 [exp] 72 / 7e-18 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10018016 [exp] 71 / 3e-17 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10029340 [exp] 70 / 3e-17 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1) Lus10005241 [exp] 69 / 6e-17 ND 96 / 4e-27 Lus10030680 [exp] 70 / 7e-17 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2) Lus10002059 [exp] 67 / 7e-16 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10004048 [exp] 66 / 1e-15 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [poplar] [flax] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Potri.014G020100.1 pacid=42763889 polypeptide=Potri.014G020100.1.p locus=Potri.014G020100 ID=Potri.014G020100.1.v4.1 annot-version=v4.1 ATGAAGCCTGTTTTTGCAGCTATTTTTCTTCTGTGCCTTGTTTTCAGTTCCTCTTTGTTTGAGGTCACAATGGCTGCCTCGGGATTCTGTGACTCGAAGT GCTCAGTGAGGTGCTCCAAAGCAGGAATTAAAGACCGGTGCTTGAAGTACTGTGGGATTTGCTGTGAAAAGTGCAAGTGCGTGCCATCTGGGACTTATGG GAACAAGCACGAGTGCCCTTGCTACAGGGACATGAAGAACTCCAAGGGCAAACCCAAGTGCCCTTGA
AA sequence Show only first row Show all	>Potri.014G020100.1 pacid=42763889 polypeptide=Potri.014G020100.1.p locus=Potri.014G020100 ID=Potri.014G020100.1.v4.1 annot-version=v4.1 MKPVFAAIFLLCLVFSSSLFEVTMAASGFCDSKCSVRCSKAGIKDRCLKYCGICCEKCKCVPSGTYGNKHECPCYRDMKNSKGKPKCP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59845			Gibberellin-regulated family p...		Potri.014G020100 [exp]	0	1
AT3G50120			Plant protein of unknown funct...		Potri.006G042946 [exp]	1.41	0.8941
AT1G80160		GLYI7	glyoxylase I 7, Lactoylglutath...		Potri.003G009000 [exp]	1.73	0.8760
ATMG00810		ATMG00810.1, OR...	DNA/RNA polymerases superfamil...		Potri.013G138801 [exp]	2.82	0.8240
AT3G55700			UDP-Glycosyltransferase superf...		Potri.010G195600 [exp]	3.16	0.8416
AT1G03790	C3HZnF	SOM	SOMNUS, Zinc finger C-x8-C-x5-...		Potri.017G013400 [exp]	3.74	0.8343
AT1G09600			Protein kinase superfamily pro...		Potri.003G003700 [exp]	4.00	0.7915
AT1G75900		EXL3	GDSL-like Lipase/Acylhydrolase...		Potri.002G018800 [exp]	5.65	0.8846
AT3G59890			Dihydrodipicolinate reductase,...		Potri.007G145900 [exp]	6.08	0.7459
AT1G53035			unknown protein		Potri.011G119200 [exp]	7.21	0.8599
AT5G25460			Protein of unknown function, D...		Potri.003G059800 [exp]	8.66	0.7938

Compare expression of checked genes

Potri.014G020100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.