Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37320 279 / 5e-90 CYP81D5 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) AT4G37370 277 / 3e-89 CYP81D8 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) AT4G37340 276 / 8e-89 CYP81D3 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) AT4G37400 275 / 1e-88 CYP81F3 "cytochrome P450, family 81, subfamily F, polypeptide 3", cytochrome P450, family 81, subfamily F, polypeptide 3 (.1) AT2G23190 275 / 5e-88 CYP81D7 "cytochrome P450, family 81, subfamily D, polypeptide 7", cytochrome P450, family 81, subfamily D, polypeptide 7 (.1) AT4G37330 264 / 3e-84 CYP81D4 "cytochrome P450, family 81, subfamily D, polypeptide 4", cytochrome P450, family 81, subfamily D, polypeptide 4 (.1) AT4G37430 262 / 2e-83 CYP81F1, CYP91A2 "cytochrome P450, family 91, subfamily A, polypeptide 2", CYTOCHROME P450 MONOOXYGENASE 81F1, cytochrome P450, family 91, subfamily A, polypeptide 2 (.1) AT5G36220 260 / 1e-82 CYP91A1, CYP81D1 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) AT2G23220 260 / 2e-82 CYP81D6 "cytochrome P450, family 81, subfamily D, polypeptide 6", cytochrome P450, family 81, subfamily D, polypeptide 6 (.1) AT3G28740 260 / 2e-82 CYP81D11, CYP81D1 cytochrome P450, family 81, subfamily D, polypeptide 11, Cytochrome P450 superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G020600 [exp] 642 / 0 AT4G37370 479 / 4e-166 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020500 [exp] 594 / 0 AT4G37370 462 / 2e-159 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020432 [exp] 585 / 0 AT4G37370 440 / 4e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121100 [exp] 530 / 0 AT4G37370 429 / 2e-146 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121200 [exp] 382 / 3e-130 AT4G37340 465 / 1e-160 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) Potri.002G121400 [exp] 382 / 6e-130 AT4G37370 470 / 1e-162 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121300 [exp] 349 / 7e-119 AT4G37370 308 / 2e-101 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G021800 [exp] 304 / 2e-99 AT4G37360 458 / 1e-157 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) Potri.003G008200 [exp] 290 / 4e-94 AT4G37370 531 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018711 [exp] 392 / 1e-133 AT4G37370 441 / 5e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10032857 [exp] 317 / 3e-107 AT4G37370 225 / 8e-70 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024819 [exp] 309 / 3e-101 AT4G37320 493 / 3e-171 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10020437 [exp] 302 / 1e-98 AT4G37370 630 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024820 [exp] 300 / 7e-98 AT5G36220 493 / 2e-171 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10024818 [exp] 291 / 2e-94 AT4G37320 480 / 2e-166 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10018717 [exp] 276 / 1e-88 AT4G37370 533 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024816 [exp] 274 / 1e-87 AT4G37370 506 / 2e-176 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10011958 [exp] 267 / 3e-85 AT5G36220 548 / 0.0 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10027614 [exp] 236 / 8e-74 AT4G37370 496 / 6e-174 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.014G020700.2 pacid=42763219 polypeptide=Potri.014G020700.2.p locus=Potri.014G020700 ID=Potri.014G020700.2.v4.1 annot-version=v4.1 ATGGCAACCTTGTTTCTCTACTTTCCGGTGTTTTTAGCCTTGTATATCATATCTACTCACTTCCTCAACAAGATAAGAAACTTCCCACCTAGTCCATTCC CTTCACTACCAATCATTGGCCACCTCTACCTACTTAAGAAGCCACTTTACAGGACACTATCAAAAATCTCCGATAAACATGGCCCCGTAATCTTGCTCCA ACTCGGGTCTCGTCGACAACTTGTTGTCTCATCCCCTTCGATAGCTGAAGAATGCTTTACCAAAAATGATGTTGTCTTTGCTAACCGCCCACGTTTGCTC TTTGTAAAACACCTCGCCTACAACAGCACAAGCCTTGGTTGGGCTCCCTATGGCGACCACTGGCGAAACCTTAGGAAGATCGTCTCTATTGAAGTCTTGT CTGCATACCGCCTCCAAATGCTTTCTTCCATACGTCTGGAGGAGGTGAAGTCAATGATTTGTGGACTCTTCCGTAATCAGAACCAGTCTGTAGATATGAG GACAGTTTTCTTCGAACTGACACTGAACATCATGATGCGGATGATAGCTGAAAAGAGATATTATGGAGGGAATGTTTCTGATGTGGAAGAAGCCAAAAGG TTTCGTGCAATTCATGCTGAAAGCTTCTTGCTAGGTGGCAAAACCATTATTGGAGACTATATACCGTGGATTAAATCAAAAGAGATGGAGAAGAGATTGA TAGAATGCAATCTCAAGAGGGATAGTTTCTTGCAGTGTTTGATAGAAGAGCAACGGAGAAAAATACTGGAGGGTGATTGCTGTGGTGAAAAGAAAAAGAA TTTGATTCAGGTTCTGCTGTCCCTGCAAGAAACTGAACCTGAGTATTACACGGACGATATCATCAAAGGGCTTGTGGTGGTGATCTTATTGGCAGGAACA CACACTTCATCCAGTACAATGGAATGGGCACTTTCACTTTTGCTTAACCATCCCCAAGTCCTCGAGAAGGCTAAAAGAGAAATCGACGAGCATATTGGGC ATGATCGTTTAATGGATGAAGCTGATCTTGCCCAAACTTCCCTACCTCCGCAGCATCCTCAACGAAACGTTACGGATGTACCCGGCAGCTCCGTTGCTAG TACCTCATGA
AA sequence Show only first row Show all	>Potri.014G020700.2 pacid=42763219 polypeptide=Potri.014G020700.2.p locus=Potri.014G020700 ID=Potri.014G020700.2.v4.1 annot-version=v4.1 MATLFLYFPVFLALYIISTHFLNKIRNFPPSPFPSLPIIGHLYLLKKPLYRTLSKISDKHGPVILLQLGSRRQLVVSSPSIAEECFTKNDVVFANRPRLL FVKHLAYNSTSLGWAPYGDHWRNLRKIVSIEVLSAYRLQMLSSIRLEEVKSMICGLFRNQNQSVDMRTVFFELTLNIMMRMIAEKRYYGGNVSDVEEAKR FRAIHAESFLLGGKTIIGDYIPWIKSKEMEKRLIECNLKRDSFLQCLIEEQRRKILEGDCCGEKKKNLIQVLLSLQETEPEYYTDDIIKGLVVVILLAGT HTSSSTMEWALSLLLNHPQVLEKAKREIDEHIGHDRLMDEADLAQTSLPPQHPQRNVTDVPGSSVASTS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G37320		CYP81D5	"cytochrome P450, family 81, s...		Potri.014G020700 [exp]	0	1
AT5G43120			ARM-repeat/Tetratricopeptide r...		Potri.007G052300 [exp]	4.00	0.9523
AT2G45560		CYP76C1	"cytochrome P450, family 76, s...		Potri.012G136800 [exp]	4.24	0.9498
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Potri.006G123400 [exp]	4.35	0.9593
AT1G56140			Leucine-rich repeat transmembr...		Potri.001G082900 [exp]	5.65	0.9574
AT2G24430	NAC	ANAC039, ANAC03...	Arabidopsis NAC domain contain...		Potri.018G003800 [exp]	6.92	0.9569
AT5G36970		NHL25	NDR1/HIN1-like 25 (.1)		Potri.015G148200 [exp]	8.36	0.9524
AT1G34670	MYB	ATMYB93	myb domain protein 93 (.1)		Potri.005G164900 [exp]	8.71	0.9543
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Potri.012G105700 [exp]	9.48	0.9412
AT4G33790		G7, FAR3, CER4	FATTY ACID REDUCTASE 3, ECERIF...		Potri.004G185100 [exp]	10.09	0.9529
AT5G06490			RING/U-box superfamily protein...		Potri.010G243500 [exp]	10.24	0.9538

Compare expression of checked genes

Potri.014G020700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.