MAF1.2 (Potri.014G021900) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol MAF1.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47200 114 / 2e-32 WPP2 WPP domain protein 2 (.1)
AT5G43070 99 / 2e-26 WPP1 WPP domain protein 1 (.1)
AT5G27940 77 / 5e-18 WPP3 WPP domain protein 3 (.1)
AT5G19320 59 / 2e-10 RANGAP2 RAN GTPase activating protein 2 (.1)
AT3G63130 51 / 1e-07 ATRANGAP1, RANGAP1 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G122000 160 / 9e-51 AT1G47200 111 / 1e-31 WPP domain protein 2 (.1)
Potri.010G091100 65 / 2e-12 AT5G19320 646 / 0.0 RAN GTPase activating protein 2 (.1)
Potri.005G209600 54 / 9e-09 AT3G63130 667 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Potri.002G052900 52 / 5e-08 AT3G63130 664 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009747 124 / 3e-36 AT1G47200 119 / 1e-34 WPP domain protein 2 (.1)
Lus10042643 114 / 2e-32 AT1G47200 125 / 4e-37 WPP domain protein 2 (.1)
Lus10010235 111 / 3e-31 AT1G47200 124 / 2e-36 WPP domain protein 2 (.1)
Lus10010523 59 / 3e-10 AT5G19320 666 / 0.0 RAN GTPase activating protein 2 (.1)
Lus10034066 58 / 4e-10 AT5G19320 669 / 0.0 RAN GTPase activating protein 2 (.1)
Lus10006930 57 / 1e-09 AT3G63130 712 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Lus10014670 56 / 4e-09 AT3G63130 717 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF13943 WPP WPP domain
Representative CDS sequence
>Potri.014G021900.1 pacid=42764457 polypeptide=Potri.014G021900.1.p locus=Potri.014G021900 ID=Potri.014G021900.1.v4.1 annot-version=v4.1
ATGTCGGACTCTGAAACTACCCCCACCGTCTCCACCACAGCACCGCCATCAGACGACCACTCCTCTGCGGAGGGTATAAAGAAGCAGGCAAGCGGCGGCT
TTTCTTTGCCATCAGACGACCACTACTCTGCGGAGGGTACAATGAAGCAGACAAGCAGCGGCTTTTCTTTTAGCATTTGGCCACCGACTCAACGCACTCG
CGACGCGATTATATCCCGTCTAATCGAGACCTTATCCACCACGTCCGTTCTCTCCAAGCGCTACGGTACTATACCTAAAGAAGAGGCCTCCGAAGCCTCC
CGCCGCATTGAGGAGGAGGCATTCTCTGGCGCCTCCACCGTGGCTTCCTCCGAGAAGGACGGGCTTGAGGTTCTCCAGCTTTACTCTAAGGAGATCAGTA
AACGGATGTTAGAGACCGTCAAGGCTCGGGCTGGATCGGGTGCCAATGGTGACAATAGTGCGACGGAGACAGCGAGCGCTGATGTGACGCCGAAGGCGGT
GGCGAATGAAGAGGTTTCGAGCTCTGCTGAGGCTGAAGCTTGA
AA sequence
>Potri.014G021900.1 pacid=42764457 polypeptide=Potri.014G021900.1.p locus=Potri.014G021900 ID=Potri.014G021900.1.v4.1 annot-version=v4.1
MSDSETTPTVSTTAPPSDDHSSAEGIKKQASGGFSLPSDDHYSAEGTMKQTSSGFSFSIWPPTQRTRDAIISRLIETLSTTSVLSKRYGTIPKEEASEAS
RRIEEEAFSGASTVASSEKDGLEVLQLYSKEISKRMLETVKARAGSGANGDNSATETASADVTPKAVANEEVSSSAEAEA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G47200 WPP2 WPP domain protein 2 (.1) Potri.014G021900 0 1 MAF1.2
AT3G08500 MYB ATMYB83 myb domain protein 83 (.1) Potri.001G267300 1.00 0.9101
AT5G23750 Remorin family protein (.1.2) Potri.001G107000 5.47 0.8974
AT4G32400 EMB42, EMB104, ... SODIUM HYPERSENSITIVE 1, EMBRY... Potri.006G252100 6.63 0.8619
AT1G72220 RING/U-box superfamily protein... Potri.002G101800 9.00 0.8906
AT2G20230 Tetraspanin family protein (.1... Potri.002G253500 9.64 0.8312
AT3G49260 IQD21 IQ-domain 21 (.1.2.3) Potri.015G012500 9.79 0.8877
AT4G37235 Uncharacterised protein family... Potri.007G033600 10.00 0.8849
AT4G32330 TPX2 (targeting protein for Xk... Potri.018G027500 10.58 0.8539
AT4G30600 signal recognition particle re... Potri.006G183600 17.29 0.8614
AT2G33385 ARPC2B actin-related protein C2B (.1.... Potri.010G067100 18.00 0.8616

Potri.014G021900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.