Plant FIBer expression Database

Potri.014G022000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G43066 39 / 3e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G122200
[exp]
113 / 2e-34 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.014G022000.2 pacid=42762914 polypeptide=Potri.014G022000.2.p locus=Potri.014G022000 ID=Potri.014G022000.2.v4.1 annot-version=v4.1
ATGGAAATCTCAATGACAAAAGGGAGCTCAATGAAGAGCCTTTGGTTTGCGTTAGGCCTAATGCTATTGGTGGTGTCGACAGAGATGAGAGTCGTCCATT
GCAGGGCCCTTCGTTCAACTTCCAGCACCATCACTACCACAGGATACCAGCAAGTAGATGGAGCTCAAGAATCGAAGGCCATGGCTTCATTTGTTGTTTC
TTCAAACAAGTCTAGCGGTCGTCCTTCGTTAAGAAGCTTGATGTTTAAATTGGCTTCTGGACCTAGCAAAAGAGGCCCTGGCCATTAA
AA sequence
>Potri.014G022000.2 pacid=42762914 polypeptide=Potri.014G022000.2.p locus=Potri.014G022000 ID=Potri.014G022000.2.v4.1 annot-version=v4.1
MEISMTKGSSMKSLWFALGLMLLVVSTEMRVVHCRALRSTSSTITTTGYQQVDGAQESKAMASFVVSSNKSSGRPSLRSLMFKLASGPSKRGPGH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G43066 unknown protein Potri.014G022000
[exp]
0 1
AT3G21420 LBO1 LATERAL BRANCHING OXIDOREDUCTA... Potri.010G200900
[exp]
2.00 0.9166
AT1G21910 AP2_ERF DREB26 dehydration response element-b... Potri.005G176000
[exp]
3.46 0.9011 DREB39
AT1G77640 AP2_ERF Integrase-type DNA-binding sup... Potri.002G085600
[exp]
6.92 0.8841 DREB41
AT3G03280 unknown protein Potri.016G128800
[exp]
9.53 0.8627
Potri.017G045000
[exp]
10.00 0.8720
AT5G47850 CCR4 CRINKLY4 related 4 (.1) Potri.019G078300
[exp]
11.40 0.8448
AT2G44890 CYP704A1 "cytochrome P450, family 704, ... Potri.012G131200
[exp]
13.67 0.8440
AT5G25810 AP2_ERF TNY, TINY TINY, Integrase-type DNA-bindi... Potri.019G067400
[exp]
13.96 0.8179
AT3G14470 NB-ARC domain-containing disea... Potri.017G133600
[exp]
14.28 0.8637
AT1G76650 CML38 calmodulin-like 38 (.1.2.3) Potri.015G093800
[exp]
15.74 0.8500

Potri.014G022000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.