Potri.014G022100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G24210 183 / 1e-59 SLY1 SLEEPY1, F-box family protein (.1)
AT5G48170 61 / 6e-12 SNE, SLY2 SNEEZY, SLEEPY2, F-box family protein (.1)
AT1G21760 47 / 2e-06 ATFBP7 F-box protein 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G122300 281 / 7e-98 AT4G24210 185 / 2e-60 SLEEPY1, F-box family protein (.1)
Potri.014G165700 67 / 3e-14 AT5G48170 144 / 9e-45 SNEEZY, SLEEPY2, F-box family protein (.1)
Potri.002G054500 54 / 1e-08 AT2G27310 122 / 2e-31 F-box family protein (.1)
Potri.004G076800 47 / 2e-06 AT5G04010 122 / 9e-33 F-box family protein (.1)
Potri.006G044801 44 / 3e-05 AT5G04010 114 / 8e-30 F-box family protein (.1)
Potri.002G082500 43 / 4e-05 AT1G21760 474 / 7e-170 F-box protein 7 (.1)
Potri.005G208200 43 / 4e-05 AT2G27310 130 / 3e-34 F-box family protein (.1)
Potri.005G178600 43 / 6e-05 AT1G21760 479 / 6e-172 F-box protein 7 (.1)
Potri.004G119500 40 / 0.0003 AT5G39250 347 / 8e-122 F-box family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042637 241 / 2e-82 AT4G24210 186 / 6e-61 SLEEPY1, F-box family protein (.1)
Lus10012335 65 / 3e-13 AT5G48170 145 / 6e-45 SNEEZY, SLEEPY2, F-box family protein (.1)
Lus10001172 64 / 7e-13 AT5G48170 164 / 2e-52 SNEEZY, SLEEPY2, F-box family protein (.1)
Lus10006381 60 / 2e-11 AT5G48170 140 / 5e-43 SNEEZY, SLEEPY2, F-box family protein (.1)
Lus10028024 47 / 4e-06 AT2G27310 158 / 4e-45 F-box family protein (.1)
Lus10042716 46 / 8e-06 AT1G69740 644 / 0.0 Aldolase superfamily protein (.1.2)
Lus10003731 45 / 2e-05 AT2G27310 160 / 3e-46 F-box family protein (.1)
Lus10029676 44 / 4e-05 AT1G21760 444 / 5e-156 F-box protein 7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Potri.014G022100.1 pacid=42762306 polypeptide=Potri.014G022100.1.p locus=Potri.014G022100 ID=Potri.014G022100.1.v4.1 annot-version=v4.1
ATGAAGCGCCCACTAGACACCGGACCCGAAATCCACAACAAAACCGACATGAAAATGAAGAAGAAAAGGCACCAAGAAGAAGGAGAAATCAAGGAAGAAA
TAGAATCCGAAACCAATACAGGAACTGGGTTTATGAATTTAGACGAGAACTTACTTTTCGAGGTGTTGAAGCATGTAGACGCGAGGACTTTAGGGAGGGC
ATCCTGTGTGAGCAAGCAGTGGCACAGGACAGTACAGGACGAGAGGTTATGGGAGCTGATCTGTACCAAGCACTGGGCTAATATTGGCTGTGGTAATCAA
CAACTGAGATCTGTTGTTTTAGCTCTTGGTGGGTTTCGTCGACTTCACTCTCAGTATCTCTGGCCCCTGTCAAAACCACACTCAACTCCTGCACCCTCTT
CTTCCTCTTCTCCTTCCGCCTGGAACCCGTTCCCGAAGATGATTGGGAACAAGCCACCGGCTAGGTGGGGCAAGGATGAGGTGCATCTGTCTCTGTCTTT
GCTTTCAATTCGGTATTATGAGAAGATGAATTTTAGTAACAGAGGAAGGTGA
AA sequence
>Potri.014G022100.1 pacid=42762306 polypeptide=Potri.014G022100.1.p locus=Potri.014G022100 ID=Potri.014G022100.1.v4.1 annot-version=v4.1
MKRPLDTGPEIHNKTDMKMKKKRHQEEGEIKEEIESETNTGTGFMNLDENLLFEVLKHVDARTLGRASCVSKQWHRTVQDERLWELICTKHWANIGCGNQ
QLRSVVLALGGFRRLHSQYLWPLSKPHSTPAPSSSSSPSAWNPFPKMIGNKPPARWGKDEVHLSLSLLSIRYYEKMNFSNRGR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G24210 SLY1 SLEEPY1, F-box family protein ... Potri.014G022100 0 1
AT2G22860 ATPSK2 phytosulfokine 2 precursor (.1... Potri.014G006900 1.41 0.9058 Pt-PSK3.2
AT1G28310 DOF AtDof1. 4 Dof-type zinc finger DNA-bindi... Potri.004G046600 1.41 0.9049
AT3G47500 DOF CDF3, AtDof3,3 cycling DOF factor 3 (.1) Potri.010G167600 3.46 0.8803
AT3G10760 GARP Homeodomain-like superfamily p... Potri.006G034900 8.48 0.8606
AT1G69588 CLE45 CLAVATA3/ESR-RELATED 45 (.1) Potri.010G169300 8.77 0.8554
AT2G31670 Stress responsive alpha-beta b... Potri.001G413500 14.96 0.8755
Potri.017G106601 15.00 0.8325
AT3G21760 HYR1 HYPOSTATIN RESISTANCE 1, UDP-G... Potri.016G014350 16.30 0.8538
AT3G61180 RING/U-box superfamily protein... Potri.002G155200 18.46 0.8416
AT1G11120 unknown protein Potri.011G045900 19.44 0.8164

Potri.014G022100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.