Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07700 233 / 6e-78 Thioredoxin superfamily protein (.1.2.3) AT4G26160 62 / 1e-11 ACHT1 atypical CYS HIS rich thioredoxin 1 (.1) AT5G42980 59 / 3e-11 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT4G29670 60 / 1e-10 ACHT2 atypical CYS HIS rich thioredoxin 2 (.1.2) AT3G51030 56 / 6e-10 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT1G19730 53 / 6e-09 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT1G45145 48 / 4e-07 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT2G33270 49 / 1e-06 ACHT3 atypical CYS HIS rich thioredoxin 3 (.1) AT5G39950 47 / 1e-06 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G08570 47 / 4e-06 ACHT4 atypical CYS HIS rich thioredoxin 4 (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G066500 [exp] 60 / 9e-11 AT4G29670 253 / 3e-85 atypical CYS HIS rich thioredoxin 2 (.1.2) Potri.006G150700 [exp] 59 / 2e-10 AT4G29670 259 / 9e-88 atypical CYS HIS rich thioredoxin 2 (.1.2) Potri.002G030000 [exp] 56 / 6e-10 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.005G232700 [exp] 55 / 1e-09 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.007G018000 [exp] 50 / 5e-08 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.008G194100 [exp] 49 / 3e-07 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.019G054800 [exp] 47 / 3e-06 AT3G02730 204 / 1e-67 thioredoxin F-type 1 (.1) Potri.019G031900 [exp] 46 / 9e-06 AT1G08570 325 / 4e-112 atypical CYS HIS rich thioredoxin 4 (.1.2.3.4) Potri.017G076700 [exp] 44 / 9e-06 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032343 [exp] 213 / 2e-68 AT1G07700 218 / 9e-71 Thioredoxin superfamily protein (.1.2.3) Lus10024726 [exp] 209 / 2e-68 AT1G07700 219 / 6e-73 Thioredoxin superfamily protein (.1.2.3) Lus10041799 [exp] 64 / 6e-13 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10028349 [exp] 64 / 8e-13 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10014277 [exp] 60 / 2e-11 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10040554 [exp] 62 / 5e-11 AT4G29670 265 / 7e-87 atypical CYS HIS rich thioredoxin 2 (.1.2) Lus10007994 [exp] 62 / 6e-11 AT4G29670 268 / 6e-88 atypical CYS HIS rich thioredoxin 2 (.1.2) Lus10024293 [exp] 50 / 8e-08 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10025979 [exp] 49 / 2e-07 AT3G51030 167 / 3e-55 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 49 / 3e-07 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00085 [poplar] [flax] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Potri.014G029200.3 pacid=42763787 polypeptide=Potri.014G029200.3.p locus=Potri.014G029200 ID=Potri.014G029200.3.v4.1 annot-version=v4.1 ATGGAAAAAGCGCGAACCTTTCTTCTCCAATTGCAACAGCATATAGATTGCGGAGGCTCGCTGAATGTTGTCATGCAAAAGCAGAACATTCTATATTCCA AGGCCTCTTTCGGTTTTGGAAGGAACCCAGATAGACAACTTGATTGTAGAATTCCTTGTGTAGCTCCAAGCATGCTTCCTTGTAGAGGTAATGAGAAGTC ATGTCTTATGAAGGCAAAATTCCCCTCTATCACTAAATATGCAGGCTTGAATTTTCCAAAAAACAACGTTGCTTCGCGGCCTGGGAGAATCAAAGCCGTG GTTGATGAAAACCCAGGTGAATTATCCGATGAAGATGATGATCTCTGTCCTGTGGATTGTGTTAGAGAATTCAAGACTGATGAGGAATTCCTTAGAATTC TTGAGAAGGCCAAAGAAACTGATTCTTTAGTGGTGGTAGATTTTTATCGCACTTCTTGTGGAAGCTGCAAGTATATAGAGCAGGGGTTTGCAAAATTGTG CAAGGGTTCTGGTGATCAAGAGGCCGCAGTAACCTTCTTAAAGCATAATGTAATTGATGAGTATGATGAACAATCTGAGGTTGCTGAACGACTTAGAATC AAGACTGTTCCCCTCTTCCACTTCTATAAAAAGGGAGTGCTGGTGGAATCGTTCCCTACCAGAGACAAAGAGAGGATTCTTGGAGCAATTCTGAAATACA CTTCACCAGCAGCTCAAGACACCTAA
AA sequence Show only first row Show all	>Potri.014G029200.3 pacid=42763787 polypeptide=Potri.014G029200.3.p locus=Potri.014G029200 ID=Potri.014G029200.3.v4.1 annot-version=v4.1 MEKARTFLLQLQQHIDCGGSLNVVMQKQNILYSKASFGFGRNPDRQLDCRIPCVAPSMLPCRGNEKSCLMKAKFPSITKYAGLNFPKNNVASRPGRIKAV VDENPGELSDEDDDLCPVDCVREFKTDEEFLRILEKAKETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQEAAVTFLKHNVIDEYDEQSEVAERLRI KTVPLFHFYKKGVLVESFPTRDKERILGAILKYTSPAAQDT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G07700			Thioredoxin superfamily protei...		Potri.014G029200 [exp]	0	1
AT4G28210		EMB1923	embryo defective 1923 (.1)		Potri.013G146900 [exp]	2.44	0.9634
AT3G09250			Nuclear transport factor 2 (NT...		Potri.016G105600 [exp]	2.44	0.9713
AT2G34620			Mitochondrial transcription te...		Potri.011G081400 [exp]	3.00	0.9606
AT1G04940		AtTic20-I, atTI...	translocon at the inner envelo...		Potri.005G231400 [exp]	3.46	0.9549
AT3G54090		FLN1	fructokinase-like 1 (.1)		Potri.016G109600 [exp]	6.92	0.9654
AT3G26740		CCL	CCR-like (.1)		Potri.001G066400 [exp]	9.32	0.9476	Pt-CR9.2
AT2G21530	FHA		SMAD/FHA domain-containing pro...		Potri.009G156900 [exp]	9.48	0.9640
AT2G04790			unknown protein		Potri.014G162700 [exp]	10.00	0.9511
AT1G54500			Rubredoxin-like superfamily pr...		Potri.005G049000 [exp]	11.83	0.9646
AT2G21530	FHA		SMAD/FHA domain-containing pro...		Potri.009G156700 [exp]	12.12	0.9633

Compare expression of checked genes

Potri.014G029200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.