Potri.014G030000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33350 359 / 5e-126 AtTic22-IV translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
AT3G23710 151 / 6e-44 AtTic22-III translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G126800 462 / 2e-166 AT4G33350 374 / 7e-132 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Potri.002G236000 164 / 3e-49 AT3G23710 351 / 7e-122 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006487 348 / 2e-121 AT4G33350 358 / 2e-125 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Lus10009759 347 / 8e-121 AT4G33350 355 / 3e-124 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Lus10022378 166 / 1e-49 AT3G23710 305 / 2e-103 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Lus10007784 143 / 3e-41 AT3G23710 257 / 2e-85 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04278 Tic22 Tic22-like family
Representative CDS sequence
>Potri.014G030000.5 pacid=42763056 polypeptide=Potri.014G030000.5.p locus=Potri.014G030000 ID=Potri.014G030000.5.v4.1 annot-version=v4.1
ATGGAACCCTCTAAACCCTCAAACCCTCTCTTATCTCTCTCAACAGTCATCCATCAACACTGCCTCCGTCTCGGTGCCGAATTCTCAGCTCGCGTCAGCG
ACACCACTCGATTCCTTGCTGGCAACTTCCCTCCACCTAGCCGGCTCCGCCTGGCGCCATCGCCGCCGTTCGCCTCTGTATCGCAGCCGAAACAAACAGC
TAACACCGCCAATCTCAGCTCGGAACACGTGGCGAAAGCTCTGGCAGGAACAGCCGTTTACACAGTGAGCAATTCTGACAATGAGTTCGTGCTTATCTCG
GATCCTAATGGAGCTAAGTCCATTGGCTTGCTTTGCTTTCGACAAGAGGACGCTGAGGCATTTCTTGCTCAGGTTAGGTTGCGGAGAAGAGAATTGCGAA
GCCAAGCTAAGGTGGTGCCTATTACACTTGACCAGGTGTACATGCTGAAGGTTGAAGGAATTGCGTTTCGGTTTTTACCTGATCCAGTTCAAATAAAGAA
TGCGTTAGAGCTCAAATCTGCTGATGTCAGGAGTGGGTTTGATGGAGTTCCTGTTTTCCAGTCGGACCAACTGATTGTGAAGAAGAAAAGCAAGAGATAC
TGCCCAGTATATTTTCAAAAGGAAGATATAGAAAAAGAACTGTCAAAGGTTTCAAGAGCATCAAGGGGTCCGGGTCTTTCTCAACATATTATGGTCGGAA
GTTTAGAGGATGTTCTGAAAAAAATGGAGATTAGTGAGAAGAATTCTGGCTGGGAAGATCTGATTTTCATTCCACCGGGTAAAAGCCATTCTCAACACAT
TCAGGAGATAACTAAGGCATGA
AA sequence
>Potri.014G030000.5 pacid=42763056 polypeptide=Potri.014G030000.5.p locus=Potri.014G030000 ID=Potri.014G030000.5.v4.1 annot-version=v4.1
MEPSKPSNPLLSLSTVIHQHCLRLGAEFSARVSDTTRFLAGNFPPPSRLRLAPSPPFASVSQPKQTANTANLSSEHVAKALAGTAVYTVSNSDNEFVLIS
DPNGAKSIGLLCFRQEDAEAFLAQVRLRRRELRSQAKVVPITLDQVYMLKVEGIAFRFLPDPVQIKNALELKSADVRSGFDGVPVFQSDQLIVKKKSKRY
CPVYFQKEDIEKELSKVSRASRGPGLSQHIMVGSLEDVLKKMEISEKNSGWEDLIFIPPGKSHSQHIQEITKA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G33350 AtTic22-IV translocon at the inner envelo... Potri.014G030000 0 1
AT4G34960 Cyclophilin-like peptidyl-prol... Potri.009G132800 4.58 0.8080
Potri.002G021900 6.78 0.8597
AT5G10910 mraW methylase family protein ... Potri.005G179700 14.49 0.8790
ATCG00330 ATCG00330.1, RP... chloroplast ribosomal protein ... Potri.013G142336 26.19 0.8154
AT4G27340 Met-10+ like family protein (.... Potri.011G125700 28.14 0.8569
AT3G47590 alpha/beta-Hydrolases superfam... Potri.018G068000 98.78 0.7510
ATCG00270 ATCG00270.1, PS... photosystem II reaction center... Potri.013G142201 142.11 0.7501
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.011G113784 153.94 0.7507
AT5G37360 unknown protein Potri.013G050300 168.46 0.7601

Potri.014G030000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.