Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18210 54 / 3e-10 Calcium-binding EF-hand family protein (.1.2) AT1G73630 52 / 1e-09 EF hand calcium-binding protein family (.1) AT3G03400 47 / 9e-08 EF hand calcium-binding protein family (.1) AT1G24620 47 / 1e-07 EF hand calcium-binding protein family (.1) AT5G42380 47 / 1e-07 CML39, CML37 CALMODULIN LIKE 39, calmodulin like 37 (.1) AT3G47480 45 / 9e-07 Calcium-binding EF-hand family protein (.1) AT2G43290 45 / 1e-06 MSS3 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) AT3G59440 44 / 3e-06 Calcium-binding EF-hand family protein (.1) AT1G32250 43 / 4e-06 Calcium-binding EF-hand family protein (.1) AT2G41090 42 / 8e-06 Calcium-binding EF-hand family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G030200 [exp] 122 / 9e-38 AT1G32250 50 / 5e-09 Calcium-binding EF-hand family protein (.1) Potri.008G079132 [exp] 66 / 2e-15 AT1G05990 45 / 5e-07 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1) Potri.008G079066 [exp] 60 / 4e-13 AT2G43290 48 / 8e-08 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) Potri.002G126900 [exp] 52 / 5e-10 AT4G26470 40 / 4e-05 Calcium-binding EF-hand family protein (.1.2) Potri.015G039500 [exp] 52 / 3e-09 AT1G18210 189 / 6e-62 Calcium-binding EF-hand family protein (.1.2) Potri.012G048200 [exp] 51 / 4e-09 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2) Potri.007G042900 [exp] 48 / 7e-08 AT2G15680 169 / 1e-53 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Potri.002G017000 [exp] 45 / 1e-06 AT1G76040 758 / 0.0 calcium-dependent protein kinase 29 (.1.2) Potri.001G138000 [exp] 44 / 1e-06 AT3G03000 221 / 8e-75 EF hand calcium-binding protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042008 [exp] 52 / 1e-09 AT1G18210 138 / 1e-42 Calcium-binding EF-hand family protein (.1.2) Lus10018012 [exp] 51 / 6e-09 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2) Lus10031345 [exp] 50 / 7e-09 AT1G18210 196 / 1e-64 Calcium-binding EF-hand family protein (.1.2) Lus10009059 [exp] 49 / 3e-08 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2) Lus10014050 [exp] 48 / 6e-08 AT2G15680 239 / 4e-81 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Lus10000972 [exp] 45 / 7e-07 AT1G21550 128 / 3e-38 Calcium-binding EF-hand family protein (.1) Lus10028657 [exp] 45 / 1e-06 AT1G21550 122 / 9e-36 Calcium-binding EF-hand family protein (.1) Lus10019863 [exp] 44 / 2e-06 AT2G15680 233 / 9e-79 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Lus10004610 [exp] 44 / 3e-06 AT3G03000 243 / 3e-83 EF hand calcium-binding protein family (.1) Lus10039986 [exp] 43 / 5e-06 AT3G07490 132 / 3e-39 calmodulin-like 3, ARF-GAP domain 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13202 [poplar] [flax] EF-hand_5 EF hand CL0220 [poplar] [flax] EF_hand PF13833 [poplar] [flax] EF-hand_8 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.014G030100.1 pacid=42764127 polypeptide=Potri.014G030100.1.p locus=Potri.014G030100 ID=Potri.014G030100.1.v4.1 annot-version=v4.1 ATGTCTCCCTGGACGCATCACCTCAAAAATATTGACAAAGGTTGCCCTAAGCCTCTTACTTCTGCATCTCCGCTAAGTGAAGAGCAATTGAATAAATTCT TCAATCGTTATGACACCAACGGAGATGGTCACCTCAGCTGGGAGGAGCTTAAAAGTGCTTACAACATCCTAGGTATGTCTTTCCCCGGCCTCAGAGCCTT GAAGGCACTCTGCGTTGCTGATGAAAATAGAGATGGATACATCAGTCAGAAAGAGTTTATCAAGCTAATGAGGAAAAAATATCGTAAATGA
AA sequence Show only first row Show all	>Potri.014G030100.1 pacid=42764127 polypeptide=Potri.014G030100.1.p locus=Potri.014G030100 ID=Potri.014G030100.1.v4.1 annot-version=v4.1 MSPWTHHLKNIDKGCPKPLTSASPLSEEQLNKFFNRYDTNGDGHLSWEELKSAYNILGMSFPGLRALKALCVADENRDGYISQKEFIKLMRKKYRK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G18210			Calcium-binding EF-hand family...		Potri.014G030100 [exp]	0	1
					Potri.005G170200 [exp]	2.00	0.8651
					Potri.008G210873 [exp]	4.47	0.8881
					Potri.009G016950 [exp]	7.41	0.8578
					Potri.010G007855 [exp]	12.24	0.8118
AT3G01960			unknown protein		Potri.001G328300 [exp]	16.43	0.8493
					Potri.008G218622 [exp]	23.49	0.8554
AT3G56630		CYP94D2	"cytochrome P450, family 94, s...		Potri.001G277301 [exp]	30.59	0.7412
AT5G66580			unknown protein		Potri.009G110700 [exp]	31.46	0.7870
AT2G04160		AIR3	AUXIN-INDUCED IN ROOT CULTURES...		Potri.011G050300 [exp]	38.61	0.8009
AT2G04160		AIR3	AUXIN-INDUCED IN ROOT CULTURES...		Potri.011G050000 [exp]	38.74	0.8080

Compare expression of checked genes

Potri.014G030100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.