Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G030500 [exp] 81 / 2e-21 ND / Potri.014G030900 [exp] 72 / 4e-18 AT1G66400 41 / 2e-05 calmodulin like 23 (.1) Potri.002G127000 [exp] 69 / 1e-16 AT4G25970 44 / 2e-06 phosphatidylserine decarboxylase 3 (.1) Potri.014G030800 [exp] 69 / 1e-16 AT3G03430 40 / 9e-06 Calcium-binding EF-hand family protein (.1) Potri.007G042700 [exp] 38 / 0.0001 AT3G20410 42 / 2e-05 calmodulin-domain protein kinase 9 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021732 [exp] 74 / 7e-19 AT1G66400 49 / 3e-08 calmodulin like 23 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF00036 [poplar] [flax] EF-hand_1 EF hand
Representative CDS sequence Show only first row Show all	>Potri.014G030700.1 pacid=42764583 polypeptide=Potri.014G030700.1.p locus=Potri.014G030700 ID=Potri.014G030700.1.v4.1 annot-version=v4.1 ATGGGAATCAAGGGTGGTGTTAATAATAGTATAATGACCTTGGAGGAGTTCAAGAAGCGGATGCTGAAAGAAATTGACGGTGATAAAGATGGCAAGATAA GCAAAGATGAACTCTCCGCCGCTGTCCGTCGCCACGGAGGATGGTTTGCTAGTTGGAAGGCCAAGTGGGGGGTATGGTCAGCTGACTCCAATGGCAATGG CTTCGTTGATGACAGTGAAATCCGTAACCTAGTGGATTTTGCTCATAAGAACTTGGGTATCAAAATTATCTTTTGA
AA sequence Show only first row Show all	>Potri.014G030700.1 pacid=42764583 polypeptide=Potri.014G030700.1.p locus=Potri.014G030700 ID=Potri.014G030700.1.v4.1 annot-version=v4.1 MGIKGGVNNSIMTLEEFKKRMLKEIDGDKDGKISKDELSAAVRRHGGWFASWKAKWGVWSADSNGNGFVDDSEIRNLVDFAHKNLGIKIIF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.014G030700 [exp]	0	1
AT4G25970		PSD3, PSD2	phosphatidylserine decarboxyla...		Potri.002G127000 [exp]	1.00	0.9594
AT1G28960		ATNUDX15, ATNUD...	ARABIDOPSIS THALIANA NUDIX HYD...		Potri.016G121500 [exp]	1.73	0.9339
AT1G70880			Polyketide cyclase/dehydrase a...		Potri.004G020100 [exp]	2.00	0.9045
					Potri.010G010416 [exp]	2.44	0.9438
AT5G42810		ATIPK1	inositol-pentakisphosphate 2-k...		Potri.005G230200 [exp]	3.00	0.8865
AT4G31240			protein kinase C-like zinc fin...		Potri.006G279400 [exp]	7.00	0.8941
AT2G20500			unknown protein		Potri.002G038400 [exp]	12.40	0.8844
					Potri.010G007932 [exp]	15.29	0.8963
					Potri.010G007987 [exp]	15.32	0.8994
AT1G70880			Polyketide cyclase/dehydrase a...		Potri.004G020000 [exp]	27.87	0.8497

Compare expression of checked genes

Potri.014G030700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.