Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03430 40 / 9e-06 Calcium-binding EF-hand family protein (.1) AT1G18530 39 / 9e-05 EF hand calcium-binding protein family (.1) AT1G66400 37 / 0.0004 CML23 calmodulin like 23 (.1) AT5G17480 36 / 0.0004 APC1 pollen calcium-binding protein 1 (.1) AT5G42380 37 / 0.0005 CML39, CML37 CALMODULIN LIKE 39, calmodulin like 37 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G030900 [exp] 168 / 3e-56 AT1G66400 41 / 2e-05 calmodulin like 23 (.1) Potri.014G030500 [exp] 124 / 8e-39 ND / Potri.002G127000 [exp] 112 / 7e-34 AT4G25970 44 / 2e-06 phosphatidylserine decarboxylase 3 (.1) Potri.014G030700 [exp] 92 / 9e-26 ND / Potri.007G042700 [exp] 79 / 2e-20 AT3G20410 42 / 2e-05 calmodulin-domain protein kinase 9 (.1) Potri.002G126900 [exp] 50 / 3e-09 AT4G26470 40 / 4e-05 Calcium-binding EF-hand family protein (.1.2) Potri.008G079132 [exp] 49 / 7e-09 AT1G05990 45 / 5e-07 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1) Potri.008G079066 [exp] 48 / 2e-08 AT2G43290 48 / 8e-08 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) Potri.014G070700 [exp] 47 / 2e-07 AT1G18210 94 / 2e-24 Calcium-binding EF-hand family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021732 [exp] 117 / 5e-36 AT1G66400 49 / 3e-08 calmodulin like 23 (.1) Lus10022343 [exp] 48 / 3e-08 AT1G76650 132 / 7e-40 calmodulin-like 38 (.1.2.3) Lus10009564 [exp] 40 / 3e-05 AT3G07490 233 / 7e-80 calmodulin-like 3, ARF-GAP domain 11 (.1) Lus10031345 [exp] 39 / 0.0001 AT1G18210 196 / 1e-64 Calcium-binding EF-hand family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13202 [poplar] [flax] EF-hand_5 EF hand
Representative CDS sequence Show only first row Show all	>Potri.014G030800.1 pacid=42763208 polypeptide=Potri.014G030800.1.p locus=Potri.014G030800 ID=Potri.014G030800.1.v4.1 annot-version=v4.1 ATGGCGATCAAGACTTGTTGCATTTCGGTGGATGGCAAACGAGTCATGAGCTTCGAGCAGTTCAAGCGGTGGTTAAAAACATTTGATGCTGACAAAGATG GCAAGTTAAGCAGAAAAGAACTTGAAGATGCCATACCTGGAGGATGGTTTACAAGGTGGAAAGGCAAGCGAAGAATACGCTCTGCAGACTCCAATGGCAA TGGCTTTATTGACGAAAGTGAAATCAACAATCTCGTGGAGTTCGCTCAAAAATACCTGGGTGTAAAGATACTGCAGTTAAAGGACGTTTAG
AA sequence Show only first row Show all	>Potri.014G030800.1 pacid=42763208 polypeptide=Potri.014G030800.1.p locus=Potri.014G030800 ID=Potri.014G030800.1.v4.1 annot-version=v4.1 MAIKTCCISVDGKRVMSFEQFKRWLKTFDADKDGKLSRKELEDAIPGGWFTRWKGKRRIRSADSNGNGFIDESEINNLVEFAQKYLGVKILQLKDV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G03430			Calcium-binding EF-hand family...		Potri.014G030800 [exp]	0	1
AT3G48660			Protein of unknown function (D...		Potri.001G058001 [exp]	1.41	0.9755
AT4G35770		ATSEN1, DIN1, S...	SENESCENCE ASSOCIATED GENE 1, ...		Potri.002G014900 [exp]	4.89	0.9696
AT4G08300			nodulin MtN21 /EamA-like trans...		Potri.005G176200 [exp]	5.65	0.9743
					Potri.007G034000 [exp]	7.54	0.9722
AT3G06240			F-box family protein (.1)		Potri.017G058900 [exp]	8.66	0.9622
AT3G16360		AHP4	HPT phosphotransmitter 4 (.1.2...		Potri.001G189900 [exp]	8.71	0.9719
AT3G16150		ASPGB1	asparaginase B1, N-terminal nu...		Potri.002G122900 [exp]	8.94	0.9604
					Potri.009G081850 [exp]	9.48	0.9709
AT4G05050		UBQ11	ubiquitin 11 (.1.2.3.4)		Potri.006G045300 [exp]	9.48	0.9684
					Potri.007G034101 [exp]	9.74	0.9715

Compare expression of checked genes

Potri.014G030800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.