Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42700 156 / 1e-47 B3 AP2/B3-like transcriptional factor family protein (.1) AT3G19184 154 / 8e-46 B3 AP2/B3-like transcriptional factor family protein (.1) AT5G58280 93 / 1e-22 B3 AP2/B3-like transcriptional factor family protein (.1) AT2G24690 44 / 7e-05 B3 REM11 Transcriptional factor B3 family protein (.1) AT5G18000 43 / 9e-05 B3 VDD VERDANDI (.1) AT2G24645 43 / 9e-05 Transcriptional factor B3 family protein (.1) AT4G33280 42 / 0.0001 B3 REM16 AP2/B3-like transcriptional factor family protein (.1) AT1G26680 42 / 0.0002 B3 REM17 transcriptional factor B3 family protein (.1) AT4G31680 42 / 0.0002 B3 REM8 Transcriptional factor B3 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G031700 [exp] 335 / 1e-117 AT5G42700 180 / 4e-57 AP2/B3-like transcriptional factor family protein (.1) Potri.009G103100 [exp] 180 / 2e-56 AT3G19184 232 / 5e-76 AP2/B3-like transcriptional factor family protein (.1) Potri.009G103200 [exp] 151 / 5e-45 AT3G19184 206 / 8e-66 AP2/B3-like transcriptional factor family protein (.1) Potri.004G141900 [exp] 115 / 6e-32 AT3G19184 137 / 7e-40 AP2/B3-like transcriptional factor family protein (.1) Potri.018G140700 [exp] 112 / 7e-29 AT3G19184 140 / 2e-38 AP2/B3-like transcriptional factor family protein (.1) Potri.009G103400 [exp] 110 / 8e-28 AT3G19184 120 / 5e-31 AP2/B3-like transcriptional factor family protein (.1) Potri.007G042500 [exp] 108 / 2e-27 AT3G19184 134 / 6e-36 AP2/B3-like transcriptional factor family protein (.1) Potri.005G137600 [exp] 108 / 2e-27 AT3G19184 135 / 2e-36 AP2/B3-like transcriptional factor family protein (.1) Potri.009G103300 [exp] 107 / 9e-27 AT3G19184 128 / 9e-34 AP2/B3-like transcriptional factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006483 [exp] 208 / 1e-67 AT5G42700 242 / 4e-81 AP2/B3-like transcriptional factor family protein (.1) Lus10009764 [exp] 204 / 4e-66 AT5G42700 229 / 3e-76 AP2/B3-like transcriptional factor family protein (.1) Lus10014044 [exp] 174 / 1e-53 AT3G19184 250 / 2e-82 AP2/B3-like transcriptional factor family protein (.1) Lus10019870 [exp] 166 / 2e-49 AT3G19184 253 / 8e-83 AP2/B3-like transcriptional factor family protein (.1) Lus10032098 [exp] 114 / 5e-29 AT3G19184 130 / 7e-34 AP2/B3-like transcriptional factor family protein (.1) Lus10007522 [exp] 108 / 4e-27 AT5G58280 206 / 9e-64 AP2/B3-like transcriptional factor family protein (.1) Lus10035416 [exp] 107 / 6e-27 AT3G19184 129 / 2e-34 AP2/B3-like transcriptional factor family protein (.1) Lus10017434 [exp] 106 / 7e-27 AT5G58280 205 / 7e-64 AP2/B3-like transcriptional factor family protein (.1) Lus10019872 [exp] 103 / 2e-25 AT3G19184 117 / 2e-30 AP2/B3-like transcriptional factor family protein (.1) Lus10019873 [exp] 100 / 4e-24 AT5G42700 121 / 6e-32 AP2/B3-like transcriptional factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.014G031600.3 pacid=42763153 polypeptide=Potri.014G031600.3.p locus=Potri.014G031600 ID=Potri.014G031600.3.v4.1 annot-version=v4.1 ATGGCGGCAAAGGTAACAGCATATGAAGAAAGTCGCCGAAAGAGAATGGAAGAGAACAAGAAAAGAATGGAAGCCCTCAATCTCCACAAGCTTTCTCGAG CTCTTAAAATTTCCACCCCTACCAAATCCTCTCCGCTGAAACGCTCAAAACCTCGAGTAGTCGAGAAACAAGTGGTTGTGGTTAGGAGGTCCAATCGTAT CGCGAACAAGCCTGCTCCTTTCTTTAAAGAAGCTGTTATTGATCGAGTGGTGATACCAAGAAGGATTTCCAAGGCAGCAGATTTGTCAAACCTGGTGTTT GCTACTGATGAAGCCAGGGCAAAGGCTATAGAGAAAGCAGAAAAGCTACAATCTGATTTAGGATCTGACTATCCGACCTTTATAAAATCAATGCTTCAAT CCCATGTTACTGGTGGATTTTGGCTGGGGTGTCTTCCACTCGACTTCTGCAGAAGGAACCTTCCAAGGCGAGGCGATTTCATCACTTTGATAGATGAAGA TGCAGATGAGTATCAAGTTACATATTTAGCACGACAGAATGGACTAAGTGGTGGATGGAAAGGGTTTGCCGTTGCTCATGGACTGCTAGATGGAGATGCT GTGGTTTTTCAGTTAATCAAGCCTACAACATGCAAGGTGGTATATATCATAAGGGTGAATGGCTCGGAACAGGGCAATAGTCTTTGA
AA sequence Show only first row Show all	>Potri.014G031600.3 pacid=42763153 polypeptide=Potri.014G031600.3.p locus=Potri.014G031600 ID=Potri.014G031600.3.v4.1 annot-version=v4.1 MAAKVTAYEESRRKRMEENKKRMEALNLHKLSRALKISTPTKSSPLKRSKPRVVEKQVVVVRRSNRIANKPAPFFKEAVIDRVVIPRRISKAADLSNLVF ATDEARAKAIEKAEKLQSDLGSDYPTFIKSMLQSHVTGGFWLGCLPLDFCRRNLPRRGDFITLIDEDADEYQVTYLARQNGLSGGWKGFAVAHGLLDGDA VVFQLIKPTTCKVVYIIRVNGSEQGNSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G42700	B3		AP2/B3-like transcriptional fa...		Potri.014G031600 [exp]	0	1
AT5G45700			Haloacid dehalogenase-like hyd...		Potri.011G072000 [exp]	2.44	0.9268
AT3G26400		EIF4B1	eukaryotic translation initiat...		Potri.014G123100 [exp]	2.82	0.9264
AT3G25980		MAD2	MITOTIC ARREST-DEFICIENT 2, DN...		Potri.008G179600 [exp]	3.46	0.9094
AT4G12540			unknown protein		Potri.013G040800 [exp]	4.24	0.9243
AT3G18800			unknown protein		Potri.019G006500 [exp]	6.24	0.8907
AT1G68350			unknown protein		Potri.008G122700 [exp]	6.48	0.9016
AT2G36200			P-loop containing nucleoside t...		Potri.006G210700 [exp]	6.92	0.8988
AT5G56120			unknown protein		Potri.011G167900 [exp]	7.74	0.8853
AT3G19184	B3		AP2/B3-like transcriptional fa...		Potri.009G103100 [exp]	8.30	0.8657
AT4G24265			unknown protein		Potri.003G001200 [exp]	8.94	0.8672

Compare expression of checked genes

Potri.014G031600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.