Potri.014G035300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G06430 251 / 8e-86 Thioredoxin superfamily protein (.1)
AT4G37200 54 / 8e-09 HCF164 HIGH CHLOROPHYLL FLUORESCENCE 164, Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G034400 55 / 4e-09 AT4G37200 305 / 5e-105 HIGH CHLOROPHYLL FLUORESCENCE 164, Thioredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021764 248 / 1e-84 AT5G06430 255 / 2e-87 Thioredoxin superfamily protein (.1)
Lus10032763 149 / 4e-46 AT5G06430 152 / 1e-47 Thioredoxin superfamily protein (.1)
Lus10016780 56 / 3e-09 AT4G37200 300 / 4e-103 HIGH CHLOROPHYLL FLUORESCENCE 164, Thioredoxin superfamily protein (.1)
Lus10022477 56 / 3e-09 AT4G37200 298 / 2e-102 HIGH CHLOROPHYLL FLUORESCENCE 164, Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00085 Thioredoxin Thioredoxin
Representative CDS sequence
>Potri.014G035300.1 pacid=42763973 polypeptide=Potri.014G035300.1.p locus=Potri.014G035300 ID=Potri.014G035300.1.v4.1 annot-version=v4.1
ATGGATCCTGTTACTAAAAAACCTTTGTTTTGTCTGAAATGGCCGTGGGATGTTGATCGACATGCGAAAAATGGGAAAGTCTGCACCTTTGAAAGTCCTT
GGCTTTTCAGGTCCTTGCAGAGTCTGGGATCCGTTGCGCTTAATTCGTTGAACTCGATTTCAGAATCCTCTAATTCTTGGATCAATAATTTTAATCCTAT
CAATCTGGGTGCGAGAACTGGCCAAGATAACTTTTTGAAGAATAAAAAAAGGGTCTTGACTCCTGAAGAGCAAGGAGAAGCAGAGCAAAGAGCATTTGCC
TCGGCACTGGCAAGTGGTAAAGAGGCTACGGTGCTTGAGTTTTATTCGCCTAGATGCAGGTTGTGCAACTCTTTGCTTAATTTTGTCCTGGAGGTAGAGG
GTAGAAACTCAAGTTGGCTCAATGTTGTAATGGCAGATGCAGAGAACGAGAAATGGCTGCCTGAGCTACTTCATTATGACATAAAATACGTTCCTTGCTT
TGTTCTGCTGGACCAAAATGGGAGGGCACTGGCAAAGACAGGAATTCCAAGCAGTCGACTACATGTAGTTGCTGGCCTCTCTCATCTTCTCAAAATAAAA
CGGGCACAGAATAATAGTGGTTGA
AA sequence
>Potri.014G035300.1 pacid=42763973 polypeptide=Potri.014G035300.1.p locus=Potri.014G035300 ID=Potri.014G035300.1.v4.1 annot-version=v4.1
MDPVTKKPLFCLKWPWDVDRHAKNGKVCTFESPWLFRSLQSLGSVALNSLNSISESSNSWINNFNPINLGARTGQDNFLKNKKRVLTPEEQGEAEQRAFA
SALASGKEATVLEFYSPRCRLCNSLLNFVLEVEGRNSSWLNVVMADAENEKWLPELLHYDIKYVPCFVLLDQNGRALAKTGIPSSRLHVVAGLSHLLKIK
RAQNNSG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G06430 Thioredoxin superfamily protei... Potri.014G035300 0 1
AT5G63140 ATPAP29, PAP29 purple acid phosphatase 29 (.1... Potri.002G183000 7.61 0.7885
AT3G46870 Pentatricopeptide repeat (PPR)... Potri.009G038200 19.44 0.7871
AT5G22660 FBD, F-box, Skp2-like and Leuc... Potri.001G337200 34.40 0.7842
AT4G34540 NmrA-like negative transcripti... Potri.009G118000 34.98 0.7804 PCBERp6
AT3G60210 GroES-like family protein (.1) Potri.002G135700 36.74 0.7412
AT4G22150 PUX3 plant UBX domain-containing pr... Potri.004G004200 43.95 0.7263
Potri.003G018400 44.58 0.7625
AT2G34470 PSKF109, UREG urease accessory protein G (.1... Potri.002G243700 44.81 0.7721 Pt-EU3.1
AT4G38250 Transmembrane amino acid trans... Potri.009G167900 52.49 0.7528 PtrANT3
AT3G30841 Cofactor-independent phosphogl... Potri.017G109500 56.78 0.7529

Potri.014G035300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.