Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26500 78 / 2e-19 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G130000 [exp] 129 / 1e-39 AT2G26500 73 / 2e-17 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3) Potri.009G108700 [exp] 109 / 6e-32 AT2G26500 95 / 2e-26 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3) Potri.004G147300 [exp] 105 / 2e-30 AT2G26500 54 / 3e-10 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011665 [exp] 40 / 9e-05 AT2G26500 105 / 2e-30 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08041 [poplar] [flax] PetM PetM family of cytochrome b6f complex subunit 7
Representative CDS sequence Show only first row Show all	>Potri.014G037000.1 pacid=42764121 polypeptide=Potri.014G037000.1.p locus=Potri.014G037000 ID=Potri.014G037000.1.v4.1 annot-version=v4.1 ATGGCAACAACAGCCGCTGCCTTTAGTCCTGCAACAATCACTGGTGCAGTCGTGGATTTTGGCAGCAAGATCCCCAAGAGAACGAACAAGGTGGTTTACA TGGGAGGAATGAATTCATATGGGGGTCTTAAAGCCCATAACAGTGTGCTTTCTCTGAACATGCCTGTGTCCACTGAGCAATGCTTTGCAAAGGTGGTTAG CTCACTGAGAGCAGCATCAAATGGGAAAGGAGGAGGTGGAGGCGCACTCTCCTCTAAATGCGGCGATGCGGGTGAGATATTCAGGATTGCTGCAATCATG AATGGCCTTGTTTTGGTTGGGGTTGCTGTTGGGTTTGTACTCCTCCGAGTTGAAGCGTGGTATGAGGAAAATGAGTGA
AA sequence Show only first row Show all	>Potri.014G037000.1 pacid=42764121 polypeptide=Potri.014G037000.1.p locus=Potri.014G037000 ID=Potri.014G037000.1.v4.1 annot-version=v4.1 MATTAAAFSPATITGAVVDFGSKIPKRTNKVVYMGGMNSYGGLKAHNSVLSLNMPVSTEQCFAKVVSSLRAASNGKGGGGGALSSKCGDAGEIFRIAAIM NGLVLVGVAVGFVLLRVEAWYEENE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G26500			cytochrome b6f complex subunit...		Potri.014G037000 [exp]	0	1
AT1G21500			unknown protein		Potri.013G128700 [exp]	1.73	0.9659
AT3G57190		PrfB3	peptide chain release factor 3...		Potri.006G045200 [exp]	2.44	0.9368
AT1G69740		HEMB1	Aldolase superfamily protein (...		Potri.002G082300 [exp]	5.09	0.9184	Pt-ALAD.1
AT3G08940		LHCB4.2	light harvesting complex photo...		Potri.006G099500 [exp]	10.39	0.9417	LHCB4.3,Lhcb4
AT2G06520		PSBX	photosystem II subunit X (.1)		Potri.006G222300 [exp]	10.95	0.9423
AT2G34430		LHCB1.4, LHB1B1	light-harvesting chlorophyll-p...		Potri.005G239300 [exp]	11.66	0.9389	LHB1.3,Lhcb1-2
AT3G54890		LHCA1	photosystem I light harvesting...		Potri.010G221100 [exp]	13.96	0.9371	1
AT3G08940		LHCB4.2	light harvesting complex photo...		Potri.016G115200 [exp]	16.49	0.9355	Pt-LHCB4.2
AT5G08280		HEMC	hydroxymethylbilane synthase (...		Potri.007G072500 [exp]	17.43	0.9243
AT1G60600		ABC4	ABERRANT CHLOROPLAST DEVELOPME...		Potri.017G050900 [exp]	18.54	0.8870

Compare expression of checked genes

Potri.014G037000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.