Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36800 136 / 5e-42 RCE1 RUB1 conjugating enzyme 1 (.1.2) AT2G18600 136 / 7e-42 Ubiquitin-conjugating enzyme family protein (.1) AT3G08690 66 / 9e-15 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT5G53300 66 / 2e-14 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT4G27960 66 / 2e-14 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT3G08700 65 / 3e-14 UBC12 ubiquitin-conjugating enzyme 12 (.1) AT5G56150 65 / 4e-14 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT1G64230 64 / 6e-14 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G41700 63 / 1e-13 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT2G16740 62 / 5e-13 UBC29 ubiquitin-conjugating enzyme 29 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T125904 [exp] 142 / 2e-44 AT4G36800 332 / 5e-118 RUB1 conjugating enzyme 1 (.1.2) Potri.009G113045 [exp] 142 / 2e-44 AT4G36800 332 / 5e-118 RUB1 conjugating enzyme 1 (.1.2) Potri.007G030900 [exp] 139 / 7e-43 AT4G36800 340 / 2e-121 RUB1 conjugating enzyme 1 (.1.2) Potri.005G126500 [exp] 130 / 2e-39 AT4G36800 332 / 3e-118 RUB1 conjugating enzyme 1 (.1.2) Potri.004G175000 [exp] 65 / 3e-14 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.006G110200 [exp] 64 / 8e-14 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.015G023300 [exp] 64 / 8e-14 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.012G033000 [exp] 64 / 8e-14 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.001G094900 [exp] 64 / 8e-14 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026038 [exp] 139 / 8e-43 AT4G36800 341 / 1e-121 RUB1 conjugating enzyme 1 (.1.2) Lus10014329 [exp] 133 / 1e-39 AT4G36800 332 / 3e-117 RUB1 conjugating enzyme 1 (.1.2) Lus10010143 [exp] 120 / 2e-35 AT4G36800 257 / 1e-88 RUB1 conjugating enzyme 1 (.1.2) Lus10032352 [exp] 64 / 6e-14 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Lus10027846 [exp] 64 / 8e-14 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 64 / 9e-14 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10039323 [exp] 64 / 9e-14 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10028700 [exp] 64 / 1e-13 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10009422 [exp] 64 / 1e-13 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10038827 [exp] 63 / 2e-13 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.014G041532.1 pacid=42764123 polypeptide=Potri.014G041532.1.p locus=Potri.014G041532 ID=Potri.014G041532.1.v4.1 annot-version=v4.1 ATGCAAGACGAAGGAATGGATGCGATGTTTGGTTCTGCCATCAATCTCTCTCAACGACAGTACTTGCCTAAGCATTGTGATCACACGGAATTTCTTTGCT GTTTGCAGGTCTACCATCCTAATATTGATCTGGAAGGCAATGTGTGCCTAAATATTCTTCGAGAAGACTGGACACCTATCCTAAATATAAACATCATCAT CTATGGATTGTTTAACCTATTCACGCAACCAAATCATGAGGATCCTCTGAATTCTGATGCAGCTAATGTGTTGAGAGATGATCCGGATGAGTTTAAATCG AACGTGAAGAGGGCAATGAGTGGTGATTCTTTAGGAGATGCTCACTTCTCTTCCTGCCTAACTTAG
AA sequence Show only first row Show all	>Potri.014G041532.1 pacid=42764123 polypeptide=Potri.014G041532.1.p locus=Potri.014G041532 ID=Potri.014G041532.1.v4.1 annot-version=v4.1 MQDEGMDAMFGSAINLSQRQYLPKHCDHTEFLCCLQVYHPNIDLEGNVCLNILREDWTPILNINIIIYGLFNLFTQPNHEDPLNSDAANVLRDDPDEFKS NVKRAMSGDSLGDAHFSSCLT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Potri.014G041532 [exp]	0	1
AT4G21390		B120	S-locus lectin protein kinase ...		Potri.001G441801 [exp]	8.66	0.7370
AT5G66360		DIM1B	adenosine dimethyl transferase...		Potri.006G264101 [exp]	9.84	0.7478
AT3G62020		GLP10	germin-like protein 10 (.1.2)		Potri.002G184900 [exp]	17.43	0.7462	GLP10.1
AT5G52300		LTI65, RD29B	RESPONSIVE TO DESSICATION 29B,...		Potri.015G143950 [exp]	19.49	0.6941
AT5G05800			unknown protein		Potri.010G019001 [exp]	20.37	0.6280
AT1G17840		AtABCG11, WBC11...	DESPERADO, CUTICULAR DEFECT AN...		Potri.017G051300 [exp]	23.32	0.6962
AT4G21390		B120	S-locus lectin protein kinase ...		Potri.001G437950 [exp]	24.69	0.7072
AT3G63440		ATCKX6, CKX6, A...	CYTOKININ OXIDASE 6, cytokinin...		Potri.003G203600 [exp]	27.98	0.6776
AT5G40940		FLA20	putative fasciclin-like arabin...		Potri.017G111600 [exp]	30.74	0.6141
AT2G26490			Transducin/WD40 repeat-like su...		Potri.002G130400 [exp]	32.68	0.7023

Compare expression of checked genes

Potri.014G041532 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.