Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47740 340 / 1e-118 PPPDE putative thiol peptidase family protein (.1.2) AT5G25170 231 / 6e-77 PPPDE putative thiol peptidase family protein (.1) AT2G25190 230 / 4e-76 PPPDE putative thiol peptidase family protein (.1) AT5G47310 226 / 2e-74 PPPDE putative thiol peptidase family protein (.1) AT4G17486 225 / 3e-74 PPPDE putative thiol peptidase family protein (.1.2) AT1G80690 223 / 2e-73 PPPDE putative thiol peptidase family protein (.1) AT4G31980 207 / 1e-62 unknown protein AT4G25680 76 / 3e-16 PPPDE putative thiol peptidase family protein (.1) AT4G25660 74 / 1e-15 PPPDE putative thiol peptidase family protein (.1) AT3G07090 57 / 1e-09 PPPDE putative thiol peptidase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G134200 [exp] 457 / 1e-165 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2) Potri.004G151200 [exp] 342 / 4e-120 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2) Potri.T126004 [exp] 339 / 7e-119 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2) Potri.009G113168 [exp] 338 / 2e-118 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2) Potri.006G261500 [exp] 234 / 7e-78 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1) Potri.003G080300 [exp] 233 / 3e-77 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1) Potri.018G021700 [exp] 233 / 4e-77 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1) Potri.001G154400 [exp] 227 / 5e-75 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1) Potri.003G180400 [exp] 224 / 8e-74 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032708 [exp] 394 / 1e-140 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2) Lus10003951 [exp] 394 / 2e-140 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2) Lus10040485 [exp] 291 / 6e-100 AT1G47740 272 / 6e-92 PPPDE putative thiol peptidase family protein (.1.2) Lus10011291 [exp] 287 / 3e-98 AT1G47740 270 / 3e-91 PPPDE putative thiol peptidase family protein (.1.2) Lus10018326 [exp] 239 / 4e-80 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1) Lus10017127 [exp] 238 / 2e-79 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1) Lus10039492 [exp] 232 / 2e-77 AT1G47740 213 / 2e-69 PPPDE putative thiol peptidase family protein (.1.2) Lus10005341 [exp] 232 / 4e-77 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1) Lus10041021 [exp] 228 / 2e-75 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1) Lus10040170 [exp] 221 / 9e-73 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF05903 [poplar] [flax] Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence Show only first row Show all	>Potri.014G042300.3 pacid=42764658 polypeptide=Potri.014G042300.3.p locus=Potri.014G042300 ID=Potri.014G042300.3.v4.1 annot-version=v4.1 ATGAAACTTGGATCAAAGAAAGTATGGAAATCCATCATACCCCTTTGCTCGAAAGGCAAATCAGCCACCCGCTTTTGTTTGTTTCCCAAACCAAGATCGG CTAGCTATGGTCCAGGCGATACACCTGTTTATCTCAACGTGTATGACTTGACGCCAATGAATGGCTACGCCTATTGGGCAGGCCTCGGCATCTTTCACTC TGGTGTGGAAGTTCATGGAGTAGAATATGCATTTGGAGCCCATGACTACCCAACAAGTGGTGTTTTTGAGGTCGAGCCTCGGCAGTGCCCAGGCTTCAAG TTCAGGAGGTCCATATTCATTGGGACCACATGCCTGGACTCCATTCAGGTTAGAGAATTCATGGAGCGGCATGCTGCGAGCTATCATGGTGATACATATC ACTTGATTGTTAAGAATTGCAACCATTTCTGCAAGGATATTTGTTACAAGCTGACTGGGAAACCAATTCCAAAGTGGGTAAATCGACTGGCAAAAATAGG TTCAATATGCAACTGCGTGCTTCCTCAATCCCTTAAAACATCTGCCGTGCGACATGACCCCTGCGGCCAACCTTATGACAGTGAGAAGAGAAGGTTAAGA AGTGCTTTTAGTTGCTTGTCTTCAATCTCAATGCGACAAAAGCAGCTGTCAACTTCTTCATTACTGCTACAATCACCTTTGAAAGGCTGCCTACCATGGG AATTGAGAAGGTCCATGAACGGTTCCTTGAAAGAAAGATGA
AA sequence Show only first row Show all	>Potri.014G042300.3 pacid=42764658 polypeptide=Potri.014G042300.3.p locus=Potri.014G042300 ID=Potri.014G042300.3.v4.1 annot-version=v4.1 MKLGSKKVWKSIIPLCSKGKSATRFCLFPKPRSASYGPGDTPVYLNVYDLTPMNGYAYWAGLGIFHSGVEVHGVEYAFGAHDYPTSGVFEVEPRQCPGFK FRRSIFIGTTCLDSIQVREFMERHAASYHGDTYHLIVKNCNHFCKDICYKLTGKPIPKWVNRLAKIGSICNCVLPQSLKTSAVRHDPCGQPYDSEKRRLR SAFSCLSSISMRQKQLSTSSLLLQSPLKGCLPWELRRSMNGSLKER

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G47740			PPPDE putative thiol peptidase...		Potri.014G042300 [exp]	0	1
AT1G19940		ATGH9B5	glycosyl hydrolase 9B5 (.1)		Potri.002G023900 [exp]	8.12	0.7099
					Potri.005G096000 [exp]	20.49	0.6459
AT1G47310			unknown protein		Potri.014G036300 [exp]	23.36	0.6845
AT5G52340		ATEXO70A2	exocyst subunit exo70 family p...		Potri.016G071000 [exp]	28.77	0.6998
AT3G57062			unknown protein		Potri.016G038300 [exp]	35.70	0.6815
AT2G37110			PLAC8 family protein (.1)		Potri.006G130300 [exp]	38.49	0.6306
AT1G32410			Vacuolar protein sorting 55 (V...		Potri.001G146600 [exp]	39.49	0.6934
AT2G30100			pentatricopeptide (PPR) repeat...		Potri.009G075200 [exp]	40.79	0.6828
AT5G15790			RING/U-box superfamily protein...		Potri.017G100100 [exp]	40.98	0.6972
AT2G34900		GTE1, GTE01, IM...	IMBIBITION-INDUCIBLE 1, GLOBAL...		Potri.001G073800 [exp]	42.70	0.6401

Compare expression of checked genes

Potri.014G042300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.