Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60966 76 / 4e-18 RING/U-box superfamily protein (.1) AT1G53820 78 / 1e-17 RING/U-box superfamily protein (.1) AT2G44578 72 / 8e-17 RING/U-box superfamily protein (.1) AT1G72310 75 / 9e-17 ATL3 RING/U-box superfamily protein (.1) AT2G44581 70 / 7e-16 RING/U-box superfamily protein (.1) AT3G14320 69 / 5e-15 Zinc finger, C3HC4 type (RING finger) family protein (.1) AT5G05280 67 / 1e-14 RING/U-box superfamily protein (.1) AT3G16720 68 / 2e-14 ATL2 TOXICOS EN LEVADURA 2 (.1) AT3G10910 66 / 4e-14 RING/U-box superfamily protein (.1) AT2G20030 67 / 1e-13 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G073300 [exp] 74 / 2e-16 AT1G53820 157 / 2e-46 RING/U-box superfamily protein (.1) Potri.008G219200 [exp] 73 / 3e-16 AT3G16720 197 / 2e-61 TOXICOS EN LEVADURA 2 (.1) Potri.001G162000 [exp] 72 / 1e-15 AT1G53820 149 / 2e-43 RING/U-box superfamily protein (.1) Potri.010G010500 [exp] 69 / 1e-14 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1) Potri.006G144200 [exp] 68 / 1e-14 AT5G17600 90 / 3e-21 RING/U-box superfamily protein (.1) Potri.005G099000 [exp] 68 / 1e-14 AT1G20823 146 / 2e-44 RING/U-box superfamily protein (.1) Potri.008G054200 [exp] 67 / 1e-14 AT1G20823 80 / 6e-19 RING/U-box superfamily protein (.1) Potri.011G063100 [exp] 68 / 2e-14 AT2G42350 106 / 3e-28 RING/U-box superfamily protein (.1) Potri.013G091300 [exp] 67 / 2e-14 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021197 [exp] 71 / 3e-15 AT1G04360 268 / 2e-87 RING/U-box superfamily protein (.1) Lus10029037 [exp] 67 / 2e-14 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1) Lus10029456 [exp] 65 / 2e-14 AT5G10380 86 / 3e-21 RING/U-box superfamily protein (.1) Lus10006493 [exp] 67 / 6e-14 AT3G16720 221 / 5e-71 TOXICOS EN LEVADURA 2 (.1) Lus10037490 [exp] 68 / 7e-14 AT3G16720 224 / 2e-70 TOXICOS EN LEVADURA 2 (.1) Lus10013210 [exp] 66 / 8e-14 AT1G20823 207 / 3e-68 RING/U-box superfamily protein (.1) Lus10005954 [exp] 66 / 3e-13 AT3G04020 111 / 7e-28 unknown protein Lus10030728 [exp] 64 / 3e-13 AT1G20823 209 / 6e-69 RING/U-box superfamily protein (.1) Lus10005818 [exp] 64 / 3e-13 AT1G49230 140 / 1e-42 RING/U-box superfamily protein (.1) Lus10025228 [exp] 63 / 4e-13 AT5G01880 97 / 5e-26 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.014G043200.1 pacid=42763444 polypeptide=Potri.014G043200.1.p locus=Potri.014G043200 ID=Potri.014G043200.1.v4.1 annot-version=v4.1 ATGATGAAAGATGAGATGGAGTTGGTGATGAGAAAAGTAGCTAGCTGTATAGCAGCCACAGCAAATTGCAAGAACACCATTGTCATCATAGCCATCATCT TTGCCATACGACTATGCACAGAGGTACTCTGGAGAAAAAACCACATCCCTTCTTTCACCTTTCGCCAAAAGCATCATCCCATAAAGAACGATGATTACGA GACCCCATATTGCGTGGTTTGCCTCCATGAAGTCGTGGATGGTGAAAGGCTGAGGAAGTTGCTGAAATGCAAGCACTGCTTCCATGTTGCGTGCATAGAC GCCTGGTTCCAGTCTCATTCCACTTGTCCTCTCTGTCGAAATCAGGTTCTTCTTCGCCATGATCATCAACATCAAAATGAAAAACGTTGTCTCTTTTTTC ATTTTCTTTCGTTTTTGCAACAAAACCAGCTTTGA
AA sequence Show only first row Show all	>Potri.014G043200.1 pacid=42763444 polypeptide=Potri.014G043200.1.p locus=Potri.014G043200 ID=Potri.014G043200.1.v4.1 annot-version=v4.1 MMKDEMELVMRKVASCIAATANCKNTIVIIAIIFAIRLCTEVLWRKNHIPSFTFRQKHHPIKNDDYETPYCVVCLHEVVDGERLRKLLKCKHCFHVACID AWFQSHSTCPLCRNQVLLRHDHQHQNEKRCLFFHFLSFLQQNQL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G60966			RING/U-box superfamily protein...		Potri.014G043200 [exp]	0	1
AT3G47510			unknown protein		Potri.015G062300 [exp]	1.00	0.8857
AT4G08900		ARGAH1	arginine amidohydrolase 1, arg...		Potri.014G067700 [exp]	1.41	0.8632	Pt-PAG1.3
AT3G28050			nodulin MtN21 /EamA-like trans...		Potri.008G145800 [exp]	2.82	0.8257
AT2G28200	C2H2ZnF		C2H2-type zinc finger family p...		Potri.016G098100 [exp]	3.46	0.8076
AT4G19810		ChiC	class V chitinase, Glycosyl hy...		Potri.018G112000 [exp]	3.46	0.8388
AT1G27660	bHLH	bHLH110	basic helix-loop-helix (bHLH) ...		Potri.005G119601 [exp]	7.00	0.8285
AT2G37130			Peroxidase superfamily protein...		Potri.006G129900 [exp]	7.21	0.8037
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Potri.001G330501 [exp]	12.00	0.7963
AT4G33420			Peroxidase superfamily protein...		Potri.004G134800 [exp]	13.19	0.8368
AT4G01700			Chitinase family protein (.1)		Potri.014G111800 [exp]	14.45	0.8085	CHI2.1

Compare expression of checked genes

Potri.014G043200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.