Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-CRK.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01710 209 / 6e-71 ARPC5, CRK CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) AT5G65274 190 / 2e-63 ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G136500 [exp] 239 / 1e-82 AT4G01710 224 / 4e-77 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028192 [exp] 214 / 8e-73 AT4G01710 236 / 5e-82 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) Lus10042895 [exp] 199 / 7e-66 AT4G01710 224 / 9e-76 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) Lus10027941 [exp] 68 / 5e-16 AT4G01710 89 / 1e-24 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1) Lus10012040 [exp] 68 / 2e-14 AT4G01710 92 / 2e-23 CROOKED, ARP2/3 complex 16 kDa subunit (p16-Arc) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04699 [poplar] [flax] P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Representative CDS sequence Show only first row Show all	>Potri.014G045200.1 pacid=42763705 polypeptide=Potri.014G045200.1.p locus=Potri.014G045200 ID=Potri.014G045200.1.v4.1 annot-version=v4.1 ATGGCAGGGAGAGGAGAGATAGTGGAAGCAGAGAGCGCAGAGGCAGAGGCTATAATCACAAGAATAGAACACAAAACTCGCAAGATCGAAAGCCTACTCA AACAGGGCAGACCCGTTGAGGCTCTCAAAACGGCTCTGGAAGGCTCGCCTCCAAAGACTCGAGATGAGAGATGCAAGTCAGCGAATTGGATAGTGGTGCA CAGAGCTCTAATGGCAATAAAAGATGTGGATTCATTGTTCTCTGCTTTAGATCCTGAGTACTATGATATTCTCATGAAGTACTTGTACAGGGGATTGTCA ACTGGAGATCGGCCCACATGCGACCAATGCCTGCGGATACATGAAAAGTTAACAGAAAAGGCTGGATTGGGTTGCATATTGCGTTCCCTTGCAGACACTG TGAATACCGTTTGA
AA sequence Show only first row Show all	>Potri.014G045200.1 pacid=42763705 polypeptide=Potri.014G045200.1.p locus=Potri.014G045200 ID=Potri.014G045200.1.v4.1 annot-version=v4.1 MAGRGEIVEAESAEAEAIITRIEHKTRKIESLLKQGRPVEALKTALEGSPPKTRDERCKSANWIVVHRALMAIKDVDSLFSALDPEYYDILMKYLYRGLS TGDRPTCDQCLRIHEKLTEKAGLGCILRSLADTVNTV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G01710		ARPC5, CRK	CROOKED, ARP2/3 complex 16 kDa...		Potri.014G045200 [exp]	0	1	Pt-CRK.1
AT2G45200		ATGOS12, GOS12	golgi snare 12 (.1.2)		Potri.002G145200 [exp]	2.00	0.8696
AT5G47635			Pollen Ole e 1 allergen and ex...		Potri.006G005600 [exp]	3.60	0.8851
AT3G52790			peptidoglycan-binding LysM dom...		Potri.008G030200 [exp]	5.47	0.8827
AT1G19130			unknown protein		Potri.006G140000 [exp]	6.32	0.8537
AT3G56250			unknown protein		Potri.013G083700 [exp]	7.54	0.8704
AT1G29200			O-fucosyltransferase family pr...		Potri.004G058900 [exp]	9.48	0.8235
AT1G16290			unknown protein		Potri.008G084100 [exp]	9.89	0.8564
AT1G67410			Exostosin family protein (.1)		Potri.008G034500 [exp]	10.48	0.8692
AT4G09060			unknown protein		Potri.002G101400 [exp]	12.64	0.8023
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Potri.016G138800 [exp]	12.96	0.8095

Compare expression of checked genes

Potri.014G045200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.