Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60370 303 / 2e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G43560 71 / 1e-14 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G19830 67 / 5e-13 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G13410 67 / 8e-13 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G05420 61 / 3e-11 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G45680 61 / 4e-11 ATFKBP13 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) AT4G25340 59 / 5e-10 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2) AT4G39710 57 / 1e-09 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) AT5G48570 57 / 5e-09 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G26555 55 / 6e-09 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G136800 [exp] 108 / 1e-30 AT3G60370 95 / 5e-26 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G068300 [exp] 73 / 3e-15 AT5G13410 332 / 4e-116 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.007G134600 [exp] 69 / 7e-14 AT2G43560 286 / 2e-98 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.017G017500 [exp] 67 / 4e-13 AT2G43560 281 / 3e-96 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G075500 [exp] 65 / 2e-12 AT5G45680 253 / 7e-86 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Potri.012G129200 [exp] 63 / 3e-11 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.015G130900 [exp] 63 / 4e-11 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.014G149400 [exp] 62 / 9e-11 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.012G119800 [exp] 60 / 2e-10 AT4G19830 270 / 5e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042897 [exp] 317 / 3e-110 AT3G60370 312 / 8e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10028194 [exp] 313 / 2e-107 AT3G60370 305 / 2e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10008359 [exp] 69 / 1e-13 AT2G43560 273 / 1e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10027115 [exp] 69 / 2e-13 AT2G43560 276 / 5e-94 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10006949 [exp] 68 / 2e-13 AT5G45680 244 / 2e-82 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Lus10024735 [exp] 63 / 4e-12 AT5G45680 194 / 1e-63 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Lus10031700 [exp] 64 / 2e-11 AT4G25340 324 / 3e-105 FK506 BINDING PROTEIN 53 (.1.2) Lus10031121 [exp] 64 / 2e-11 AT4G25340 335 / 3e-110 FK506 BINDING PROTEIN 53 (.1.2) Lus10009828 [exp] 62 / 4e-11 AT5G13410 314 / 1e-108 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10040937 [exp] 61 / 7e-11 AT5G13410 317 / 1e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [poplar] [flax] FKBP PF00254 [poplar] [flax] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Potri.014G045600.2 pacid=42763380 polypeptide=Potri.014G045600.2.p locus=Potri.014G045600 ID=Potri.014G045600.2.v4.1 annot-version=v4.1 ATGCTGACAGCAACCTCATCGTTCTATCCTCTCCTGTCTAAGCCATCTTCTCCTCACATAAACCTTATACCATGTCCTGCTTTGGGAGATCTCTTTTCTT TGAAGAAGCGAATGGTACGGTGTTGTCACAACTTGAATGATGATGGAATGCAGAATGGACATGTAGTATTATGTCATGAAGAGAAATTGAGGCGTAGGTT CCTCCTCTTCTTTTCTTTCTCATCAGGCTTGCTTTCAACTTTTCCTTCTTATGGAAAGACAAAGAGCAAGAACCCGTATGACGAAAGACGCTTGCTGGAA CAAAACAAGCGGATCCAGAAAGAGAACAATGTACCTGAAGACTTCCCAAGTTTTATCAGAGAAGGTTTTGAGGTTAAGGTAGTAGCACCAGAGAATTATA TAAAACGTGACTCAGGGCTTATATACCGGGATTTTGAAGTTGGTGAAGGTGATTGCCCAAAGGATGGCCAACAGGTGACTTTCCACTATGTTGGCTATAA TGAGTCAGGTCGTCGCATTGACAGCACCTACTTACAGGGTTCTCCTGCGAAAATCCGCATGGGCACTAATGCATTGATTCCAGGATTTGAGGAAGGAATT CGAGACATGAGACCTGGGGGGAAGAGGAGGATAATCGTTCCTCCAGAACTTGGGCCACCGGTTGGACCTTCCACTTTTTTCAGCTCAAAACAGTTCGAAG TTTTTGATGTGGAACTTCTCAACGTTAAGGACTGTCAAAGGAGGACTATAGGATTTTACTCTGATGTTGTGTGCAACTGA
AA sequence Show only first row Show all	>Potri.014G045600.2 pacid=42763380 polypeptide=Potri.014G045600.2.p locus=Potri.014G045600 ID=Potri.014G045600.2.v4.1 annot-version=v4.1 MLTATSSFYPLLSKPSSPHINLIPCPALGDLFSLKKRMVRCCHNLNDDGMQNGHVVLCHEEKLRRRFLLFFSFSSGLLSTFPSYGKTKSKNPYDERRLLE QNKRIQKENNVPEDFPSFIREGFEVKVVAPENYIKRDSGLIYRDFEVGEGDCPKDGQQVTFHYVGYNESGRRIDSTYLQGSPAKIRMGTNALIPGFEEGI RDMRPGGKRRIIVPPELGPPVGPSTFFSSKQFEVFDVELLNVKDCQRRTIGFYSDVVCN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G60370			FKBP-like peptidyl-prolyl cis-...		Potri.014G045600 [exp]	0	1
AT1G16080			unknown protein		Potri.003G185501 [exp]	5.65	0.9586
AT2G21530	FHA		SMAD/FHA domain-containing pro...		Potri.009G156900 [exp]	8.12	0.9563
AT2G21530	FHA		SMAD/FHA domain-containing pro...		Potri.009G156700 [exp]	13.22	0.9511
AT1G54500			Rubredoxin-like superfamily pr...		Potri.005G049000 [exp]	15.39	0.9518
AT1G16080			unknown protein		Potri.003G185754 [exp]	16.24	0.9468
AT3G54210			Ribosomal protein L17 family p...		Potri.016G143100 [exp]	19.74	0.9501
AT1G07700			Thioredoxin superfamily protei...		Potri.014G029200 [exp]	20.97	0.9423
AT5G41761			unknown protein		Potri.003G136700 [exp]	23.91	0.9290
					Potri.001G230200 [exp]	26.26	0.9298
AT1G03600		PSB27	photosystem II family protein ...		Potri.005G206200 [exp]	30.00	0.9353

Compare expression of checked genes

Potri.014G045600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.