Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G59310 67 / 1e-15 LTP4 lipid transfer protein 4 (.1) AT5G59320 63 / 5e-14 LTP3 lipid transfer protein 3 (.1) AT3G51600 61 / 6e-13 LTP5 lipid transfer protein 5 (.1) AT3G51590 61 / 6e-13 LTP12 lipid transfer protein 12 (.1) AT2G15050 59 / 5e-12 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT2G38540 56 / 5e-11 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT2G38530 55 / 1e-10 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT2G18370 48 / 4e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G01870 46 / 3e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086600 [exp] 61 / 7e-13 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.006G108100 [exp] 59 / 4e-12 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 58 / 5e-12 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.001G232700 [exp] 58 / 9e-12 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086500 [exp] 55 / 1e-10 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232900 [exp] 54 / 2e-10 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135700 [exp] 47 / 9e-08 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.009G025200 [exp] 45 / 7e-07 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G136000 [exp] 41 / 1e-05 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001703 [exp] 95 / 3e-26 AT4G33355 86 / 9e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005156 [exp] 94 / 2e-23 AT3G55400 931 / 0.0 OVULE ABORTION 1, methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) (.1), methionyl-tRNA synthetase / methionine--tRNA ligase / MetRS (cpMetRS) (.2) Lus10040917 [exp] 75 / 1e-16 AT4G01030 898 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10029445 [exp] 71 / 1e-16 AT4G33355 103 / 2e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10009813 [exp] 74 / 3e-16 AT4G01030 820 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10025151 [exp] 63 / 6e-14 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10015279 [exp] 62 / 2e-13 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10025234 [exp] 61 / 5e-13 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10026418 [exp] 61 / 6e-13 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10025231 [exp] 59 / 3e-12 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF00234 [poplar] [flax] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Potri.014G046500.1 pacid=42763752 polypeptide=Potri.014G046500.1.p locus=Potri.014G046500 ID=Potri.014G046500.1.v4.1 annot-version=v4.1 ATGAAGGGAGCAATCATTTCCATGTTGGTTGCTGTAGCCATGGTTCAATTCATGGTTAAGCCAGGAGAGGCCATCACCTGTGGGGACGTGAACTCAGACT TGTCTGCTTGCGTTTCCTATCTCACCGGAAAAGGTGGCGATTTCCCTCCACCACAATGTTGTGCCGGGGTGAACAAATTGAAGGAAAGTGCTGTCAGCAT TGCAGATAAGCAAGCTGCATGTGAATGTGTCAAGGCAGCCGCTGCTCGCCTCCCAGATATGAAGGATGAGGCTGCATCCTCTCTCCCTGCCAAGTGCAAG GTTCAAGTGGACGTTCCCATCTCCAAAAACTTCAATTGTGCCGACATTCACTAA
AA sequence Show only first row Show all	>Potri.014G046500.1 pacid=42763752 polypeptide=Potri.014G046500.1.p locus=Potri.014G046500 ID=Potri.014G046500.1.v4.1 annot-version=v4.1 MKGAIISMLVAVAMVQFMVKPGEAITCGDVNSDLSACVSYLTGKGGDFPPPQCCAGVNKLKESAVSIADKQAACECVKAAAARLPDMKDEAASSLPAKCK VQVDVPISKNFNCADIH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G33355			Bifunctional inhibitor/lipid-t...		Potri.014G046500 [exp]	0	1
					Potri.011G073116 [exp]	1.41	1.0000
					Potri.014G075251 [exp]	2.00	1.0000
AT4G18550		AtDSEL	Arabidopsis thaliana DAD1-like...		Potri.004G054600 [exp]	3.46	0.9999
AT5G62360			Plant invertase/pectin methyle...		Potri.015G128400 [exp]	3.87	0.9999
AT2G20870			cell wall protein precursor, p...		Potri.013G144200 [exp]	4.47	0.9997
AT1G33811			GDSL-like Lipase/Acylhydrolase...		Potri.013G102400 [exp]	4.47	0.9999
AT2G42990			GDSL-like Lipase/Acylhydrolase...		Potri.002G219700 [exp]	6.32	0.9998
					Potri.007G113350 [exp]	6.48	0.9999
AT4G38770		ATPRP4, PRP4	ARABIDOPSIS THALIANA PROLINE-R...		Potri.009G129900 [exp]	7.00	0.9998	PRP4.4
AT2G18420			Gibberellin-regulated family p...		Potri.013G113400 [exp]	8.48	0.9997

Compare expression of checked genes

Potri.014G046500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.