Potri.014G050400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44740 285 / 8e-99 CYCP4;1 cyclin p4;1 (.1)
AT5G61650 231 / 2e-77 CYCP4;2 CYCLIN P4;2 (.1)
AT5G07450 226 / 1e-75 CYCP4;3 cyclin p4;3 (.1)
AT3G63120 156 / 8e-48 CYCP1;1 cyclin p1;1 (.1)
AT3G21870 149 / 2e-45 CYCP2;1 cyclin p2;1 (.1)
AT3G05327 149 / 5e-45 Cyclin family protein (.1)
AT2G45080 149 / 5e-45 CYCP3;1 cyclin p3;1 (.1)
AT3G60550 145 / 1e-43 CYCP3;2 cyclin p3;2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G112140 322 / 2e-113 AT2G44740 274 / 1e-94 cyclin p4;1 (.1)
Potri.012G114600 318 / 1e-111 AT2G44740 277 / 2e-95 cyclin p4;1 (.1)
Potri.002G052800 176 / 3e-55 AT3G63120 219 / 1e-71 cyclin p1;1 (.1)
Potri.005G209800 174 / 5e-55 AT3G63120 223 / 7e-74 cyclin p1;1 (.1)
Potri.007G121500 172 / 4e-54 AT3G21870 228 / 5e-76 cyclin p2;1 (.1)
Potri.013G023000 159 / 2e-49 AT3G05327 194 / 4e-63 Cyclin family protein (.1)
Potri.005G033600 156 / 4e-48 AT3G05327 184 / 5e-59 Cyclin family protein (.1)
Potri.002G143400 152 / 2e-46 AT2G45080 324 / 1e-113 cyclin p3;1 (.1)
Potri.014G066400 148 / 1e-44 AT3G60550 343 / 3e-121 cyclin p3;2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032505 246 / 5e-83 AT2G44740 228 / 7e-76 cyclin p4;1 (.1)
Lus10043003 243 / 6e-82 AT2G44740 227 / 2e-75 cyclin p4;1 (.1)
Lus10022038 176 / 1e-55 AT3G63120 197 / 8e-64 cyclin p1;1 (.1)
Lus10004475 173 / 1e-54 AT3G05327 171 / 1e-53 Cyclin family protein (.1)
Lus10029933 172 / 2e-54 AT3G05327 172 / 3e-54 Cyclin family protein (.1)
Lus10042582 171 / 1e-53 AT3G63120 191 / 2e-61 cyclin p1;1 (.1)
Lus10039697 170 / 4e-53 AT3G21870 236 / 3e-79 cyclin p2;1 (.1)
Lus10027148 167 / 3e-51 AT3G21870 233 / 6e-77 cyclin p2;1 (.1)
Lus10042873 153 / 1e-46 AT3G60550 300 / 8e-104 cyclin p3;2 (.1)
Lus10028174 146 / 3e-44 AT2G45080 249 / 1e-84 cyclin p3;1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0065 Cyclin PF00134 Cyclin_N Cyclin, N-terminal domain
Representative CDS sequence
>Potri.014G050400.1 pacid=42763117 polypeptide=Potri.014G050400.1.p locus=Potri.014G050400 ID=Potri.014G050400.1.v4.1 annot-version=v4.1
ATGGCAGAGCTAGAGAGTACAAAGATGATGCCAAAATCAATCACATTTCTCTCTTCTTTGCTTCAAAGGGTTGCTGATTCTAATGATCTTAACCGCGAGT
TTCAGCCACAGAAAATCTCGGTCTTCCATGGACTAACTAGGCCAACTATCTCTATTCAAAGTTACTTGGAGAGAATTTTCAAGTACGCAAATTGTAGCCC
TTCTTGCTTTGTTGTTGCGTATGTGTATCTTGATAGGTTTGCTCAAAGACAACCTTCTTTGCCTATCAATTCTCTCAATGTTCATCGGTTGCTTATAACA
AGTGTCTTGGTTTCTGCTAAGTTCATGGATGACATGTATTACAACAATGCTTACTATGCAAGAGTTGGAGGGATAAGCACGATTGAGATGAACTATCTAG
AAGTGGATTTTCTATTTGGATTAGGCTTCAATTTAAATGTGACTCCAAACACCTTCCACACTTATTGCTCCTACCTTCAGAGAGAGATGATGCAACAACC
TTCTCTGAATTTAGCTGAATCTTCATTGAACTTGGGGAGATCACTAAAAGTCCACTTGTGCTTCAATGAAGATGAGACATCCCATCAACAACAGCAACTT
GCTGTTTAA
AA sequence
>Potri.014G050400.1 pacid=42763117 polypeptide=Potri.014G050400.1.p locus=Potri.014G050400 ID=Potri.014G050400.1.v4.1 annot-version=v4.1
MAELESTKMMPKSITFLSSLLQRVADSNDLNREFQPQKISVFHGLTRPTISIQSYLERIFKYANCSPSCFVVAYVYLDRFAQRQPSLPINSLNVHRLLIT
SVLVSAKFMDDMYYNNAYYARVGGISTIEMNYLEVDFLFGLGFNLNVTPNTFHTYCSYLQREMMQQPSLNLAESSLNLGRSLKVHLCFNEDETSHQQQQL
AV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G44740 CYCP4;1 cyclin p4;1 (.1) Potri.014G050400 0 1
AT4G05520 ATEHD2 EPS15 homology domain 2 (.1.2) Potri.011G022300 11.04 0.7893
AT1G08880 HTA5 ,G-H2AX ,G... histone H2A 5, gamma histone v... Potri.013G028800 16.18 0.7828
AT4G04930 DES-1-LIKE fatty acid desaturase family p... Potri.011G050800 27.14 0.7494
AT5G65360 Histone superfamily protein (.... Potri.001G016900 30.59 0.7535
AT2G25620 AtDBP1 DNA-binding protein phosphatas... Potri.018G033000 31.17 0.7222
AT3G54690 SETH3 Sugar isomerase (SIS) family p... Potri.005G225700 34.59 0.7373
AT1G47740 PPPDE putative thiol peptidase... Potri.004G151200 35.19 0.7361
AT1G08880 HTA5 ,G-H2AX ,G... histone H2A 5, gamma histone v... Potri.005G040700 36.85 0.7454
AT4G23490 Protein of unknown function (D... Potri.001G100700 37.10 0.7078
AT5G65360 Histone superfamily protein (.... Potri.002G028800 37.30 0.7550

Potri.014G050400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.