Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51160 67 / 2e-13 Ankyrin repeat family protein (.1) AT4G11000 59 / 1e-10 Ankyrin repeat family protein (.1) AT5G50140 57 / 8e-10 Ankyrin repeat family protein (.1) AT2G24600 56 / 1e-09 Ankyrin repeat family protein (.1.2.3.4) AT1G34050 56 / 2e-09 Ankyrin repeat family protein (.1) AT1G10340 54 / 6e-09 Ankyrin repeat family protein (.1.2) AT5G54700 54 / 1e-08 Ankyrin repeat family protein (.1) AT3G13950 52 / 2e-08 unknown protein AT4G10720 51 / 9e-08 Ankyrin repeat family protein (.1.2) AT4G03500 50 / 1e-07 Ankyrin repeat family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G050700 [exp] 238 / 4e-81 AT5G51160 56 / 2e-09 Ankyrin repeat family protein (.1) Potri.014G050800 [exp] 134 / 6e-40 AT5G51160 87 / 5e-20 Ankyrin repeat family protein (.1) Potri.001G444300 [exp] 132 / 2e-39 AT1G34050 66 / 1e-12 Ankyrin repeat family protein (.1) Potri.001G443600 [exp] 131 / 4e-39 AT1G34050 62 / 9e-12 Ankyrin repeat family protein (.1) Potri.014G050532 [exp] 129 / 3e-38 AT2G24600 69 / 1e-13 Ankyrin repeat family protein (.1.2.3.4) Potri.014G050900 [exp] 114 / 3e-32 AT5G51160 81 / 9e-18 Ankyrin repeat family protein (.1) Potri.015G111300 [exp] 77 / 1e-16 AT5G51160 338 / 2e-112 Ankyrin repeat family protein (.1) Potri.012G113800 [exp] 76 / 2e-16 AT5G51160 351 / 1e-117 Ankyrin repeat family protein (.1) Potri.006G223800 [exp] 75 / 3e-16 AT5G51160 176 / 1e-49 Ankyrin repeat family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041537 [exp] 86 / 6e-20 AT5G51160 350 / 2e-117 Ankyrin repeat family protein (.1) Lus10038608 [exp] 57 / 6e-10 AT1G10340 168 / 2e-47 Ankyrin repeat family protein (.1.2) Lus10024844 [exp] 57 / 1e-09 AT1G34050 353 / 4e-114 Ankyrin repeat family protein (.1) Lus10037894 [exp] 56 / 2e-09 AT1G10340 298 / 3e-93 Ankyrin repeat family protein (.1.2) Lus10024845 [exp] 54 / 8e-09 AT2G24600 193 / 5e-58 Ankyrin repeat family protein (.1.2.3.4) Lus10029007 [exp] 54 / 1e-08 AT5G51160 128 / 4e-32 Ankyrin repeat family protein (.1) Lus10018757 [exp] 54 / 1e-08 AT1G34050 298 / 3e-93 Ankyrin repeat family protein (.1) Lus10034255 [exp] 49 / 5e-07 AT5G51160 125 / 4e-31 Ankyrin repeat family protein (.1) Lus10034256 [exp] 48 / 8e-07 AT5G51160 140 / 2e-36 Ankyrin repeat family protein (.1) Lus10029008 [exp] 48 / 9e-07 AT5G51160 121 / 8e-30 Ankyrin repeat family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF13962 [poplar] [flax] PGG Domain of unknown function
Representative CDS sequence Show only first row Show all	>Potri.014G050600.1 pacid=42763483 polypeptide=Potri.014G050600.1.p locus=Potri.014G050600 ID=Potri.014G050600.1.v4.1 annot-version=v4.1 ATGGAAAGTACAAGTAACAAAACCAAAATCAAGCCCTTACAAGATATTATATTGCCAACAAGACCGCCATGGAAAACAGAGACAAATGGTGACATCCGAA ATGTTATGCTAGTCGGGGCTGCGCTGATCGCGACGGTGACCTTCCAAGCTGGAATCACCCCACCTGGTGGAGTTTGGCAAAGCGATGATAATCAGGGACA TAGAGCTGGACATGCTGTTTATTCTGATCAGAAAGTTCCTTTCCAAATCTTCCTGATATGCAACACCATTGCACTAACGTCCTCCATTTTTCTCTTATTA TGTCTAACCTTCGGTTACCCATATTTCTTGGAAGTCTTGATTGCTACAATTTCTATGATGGGCACTTACAGTTCTGGGATATATTGTATTACACCTTACG AATCAGTGTCCTTTCGCCTCATCTTCGTCGCTGCTCCTGCGCCTATTGTAATACGGTTTGTCATATGGGTGGTAGCCTCCGCAGTTCGCCATCTAAGACA ATTACCAATATCAAAGTAA
AA sequence Show only first row Show all	>Potri.014G050600.1 pacid=42763483 polypeptide=Potri.014G050600.1.p locus=Potri.014G050600 ID=Potri.014G050600.1.v4.1 annot-version=v4.1 MESTSNKTKIKPLQDIILPTRPPWKTETNGDIRNVMLVGAALIATVTFQAGITPPGGVWQSDDNQGHRAGHAVYSDQKVPFQIFLICNTIALTSSIFLLL CLTFGYPYFLEVLIATISMMGTYSSGIYCITPYESVSFRLIFVAAPAPIVIRFVIWVVASAVRHLRQLPISK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G51160			Ankyrin repeat family protein ...		Potri.014G050600 [exp]	0	1
AT3G50160			Plant protein of unknown funct...		Potri.006G042300 [exp]	2.00	0.9780
AT5G48500			unknown protein		Potri.002G250800 [exp]	2.44	0.9730
					Potri.016G136800 [exp]	2.82	0.9796
AT5G41470			Nuclear transport factor 2 (NT...		Potri.002G070800 [exp]	7.54	0.9775
AT1G14730			Cytochrome b561/ferric reducta...		Potri.010G102400 [exp]	9.74	0.9733
AT1G63310			unknown protein		Potri.001G452900 [exp]	9.79	0.9764
AT5G24560		ATPP2-B12	phloem protein 2-B12 (.1)		Potri.015G120300 [exp]	13.78	0.9482
AT3G20570		AtENODL9	early nodulin-like protein 9 (...		Potri.001G419200 [exp]	14.14	0.9695
AT3G17730	NAC	ANAC057	NAC domain containing protein ...		Potri.015G030200 [exp]	15.00	0.9688	NAC017
AT1G23530			unknown protein		Potri.010G041600 [exp]	15.65	0.9697

Compare expression of checked genes

Potri.014G050600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.