Potri.014G050800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G51160 88 / 2e-20 Ankyrin repeat family protein (.1)
AT1G34050 60 / 1e-10 Ankyrin repeat family protein (.1)
AT5G50140 59 / 4e-10 Ankyrin repeat family protein (.1)
AT4G13266 55 / 4e-09 unknown protein
AT5G54710 55 / 7e-09 Ankyrin repeat family protein (.1)
AT3G13950 53 / 1e-08 unknown protein
AT4G11000 53 / 2e-08 Ankyrin repeat family protein (.1)
AT2G24600 51 / 2e-07 Ankyrin repeat family protein (.1.2.3.4)
AT5G54700 50 / 3e-07 Ankyrin repeat family protein (.1)
AT1G10340 47 / 2e-06 Ankyrin repeat family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G050900 226 / 9e-76 AT5G51160 81 / 9e-18 Ankyrin repeat family protein (.1)
Potri.001G444300 206 / 3e-68 AT1G34050 66 / 1e-12 Ankyrin repeat family protein (.1)
Potri.001G443600 200 / 6e-66 AT1G34050 62 / 9e-12 Ankyrin repeat family protein (.1)
Potri.014G050532 196 / 6e-64 AT2G24600 69 / 1e-13 Ankyrin repeat family protein (.1.2.3.4)
Potri.014G050700 140 / 7e-42 AT5G51160 56 / 2e-09 Ankyrin repeat family protein (.1)
Potri.014G050600 135 / 4e-40 AT5G51160 67 / 3e-13 Ankyrin repeat family protein (.1)
Potri.012G113800 101 / 3e-25 AT5G51160 351 / 1e-117 Ankyrin repeat family protein (.1)
Potri.015G111300 100 / 1e-24 AT5G51160 338 / 2e-112 Ankyrin repeat family protein (.1)
Potri.006G223800 86 / 1e-19 AT5G51160 176 / 1e-49 Ankyrin repeat family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041537 108 / 7e-28 AT5G51160 350 / 2e-117 Ankyrin repeat family protein (.1)
Lus10029007 60 / 2e-10 AT5G51160 128 / 4e-32 Ankyrin repeat family protein (.1)
Lus10038608 58 / 7e-10 AT1G10340 168 / 2e-47 Ankyrin repeat family protein (.1.2)
Lus10037894 57 / 2e-09 AT1G10340 298 / 3e-93 Ankyrin repeat family protein (.1.2)
Lus10034255 57 / 2e-09 AT5G51160 125 / 4e-31 Ankyrin repeat family protein (.1)
Lus10024844 57 / 2e-09 AT1G34050 353 / 4e-114 Ankyrin repeat family protein (.1)
Lus10018757 56 / 4e-09 AT1G34050 298 / 3e-93 Ankyrin repeat family protein (.1)
Lus10034256 56 / 5e-09 AT5G51160 140 / 2e-36 Ankyrin repeat family protein (.1)
Lus10029008 55 / 6e-09 AT5G51160 121 / 8e-30 Ankyrin repeat family protein (.1)
Lus10024845 53 / 2e-08 AT2G24600 193 / 5e-58 Ankyrin repeat family protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF13962 PGG Domain of unknown function
Representative CDS sequence
>Potri.014G050800.2 pacid=42763462 polypeptide=Potri.014G050800.2.p locus=Potri.014G050800 ID=Potri.014G050800.2.v4.1 annot-version=v4.1
ATGGCTCAAGTACACCCTCAAAATACCGAGAGAAGAATTAACTGGTTAAAGAGATTTCAATATGATAAAGAAAGGGACTCACCAAATGATGTGCGAAATG
TTTTGCTGGTAATTGCCACACTGATTGCTGCAGTGACCTTCCAAGCTGGGGTGAATCCTCCTGGTGGAGTCTGGCAGGATGATAATGGTATCAAACCTGC
CGCTGGGGCGAATCCTCCTAGTCCTGGAGGAGAACGGCAGGAATACAAGTTTGAAGAACATCATGCCGCTGGCAGAGCAATTTATGCGTCTCAAAAACAT
CCTTACTATGTTTTCTTGATGTCAAACACTTTGGCATTCTCCGCATCATTACTTGTTATCCCATCTCTCACTTACAAGTTCCCTTTCCACTTTGAGATTT
GGGTTGCCACAGCTTCAATGATGGTAACTTATGCTTCTGCAATTTTTGCTGTTACCCCTCGTGAATCTGTGCATTTTCGCTATCTCTTGATTACAGCTGC
AGTGCCTTTTATCACAAGGTTTTTGATCCAGAAGCTTAAGAAAAGCAGTAAAAAATCTCAGAAAGATGAAGAAATAGGTGGGGAAACAGGCCAAAGTGTG
TAG
AA sequence
>Potri.014G050800.2 pacid=42763462 polypeptide=Potri.014G050800.2.p locus=Potri.014G050800 ID=Potri.014G050800.2.v4.1 annot-version=v4.1
MAQVHPQNTERRINWLKRFQYDKERDSPNDVRNVLLVIATLIAAVTFQAGVNPPGGVWQDDNGIKPAAGANPPSPGGERQEYKFEEHHAAGRAIYASQKH
PYYVFLMSNTLAFSASLLVIPSLTYKFPFHFEIWVATASMMVTYASAIFAVTPRESVHFRYLLITAAVPFITRFLIQKLKKSSKKSQKDEEIGGETGQSV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G51160 Ankyrin repeat family protein ... Potri.014G050800 0 1
AT1G08970 CCAAT NF-YC9, HAP5C "nuclear factor Y, subunit C9"... Potri.005G035800 3.46 0.7518 HAP5.6
Potri.006G090066 4.12 0.7407
AT1G13480 Protein of unknown function (D... Potri.008G109500 17.20 0.7806
Potri.016G102401 30.26 0.6642
AT3G59480 pfkB-like carbohydrate kinase ... Potri.007G129700 89.38 0.6774
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Potri.012G105600 96.34 0.7235
AT5G62170 unknown protein Potri.012G132900 100.00 0.6705
AT5G48920 TED7 tracheary element differentiat... Potri.007G108100 114.25 0.6907
AT3G21710 unknown protein Potri.014G151900 125.27 0.7160
AT1G75800 Pathogenesis-related thaumatin... Potri.005G240900 145.24 0.6502

Potri.014G050800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.