Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24910 242 / 3e-76 ELA1, CYP714A1 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) AT5G24900 223 / 3e-69 ELA2, CYP714A2 EUI-like p450 A2, cytochrome P450, family 714, subfamily A, polypeptide 2 (.1) AT4G27710 172 / 1e-49 CYP709B3 "cytochrome P450, family 709, subfamily B, polypeptide 3", cytochrome P450, family 709, subfamily B, polypeptide 3 (.1) AT2G46950 171 / 8e-49 CYP709B2 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) AT1G75130 169 / 2e-48 CYP721A1 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) AT2G26710 167 / 5e-48 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) AT2G46960 160 / 3e-46 CYP709B1 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2) AT3G14620 160 / 2e-45 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) AT3G14640 160 / 2e-45 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) AT3G14630 160 / 3e-45 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G160800 [exp] 285 / 3e-93 AT5G24910 468 / 6e-161 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.008G026300 [exp] 275 / 2e-89 AT5G24910 486 / 5e-168 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.008G026200 [exp] 274 / 8e-89 AT5G24910 488 / 8e-169 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.010G116300 [exp] 243 / 5e-77 AT5G24910 376 / 3e-125 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.019G064200 [exp] 221 / 2e-68 AT5G24910 652 / 0.0 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Potri.006G022200 [exp] 174 / 2e-50 AT2G46950 527 / 0.0 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Potri.011G099200 [exp] 169 / 6e-50 AT3G14660 466 / 3e-163 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) Potri.011G101500 [exp] 170 / 5e-49 AT3G14690 609 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G099400 [exp] 169 / 1e-48 AT3G14690 613 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008423 [exp] 303 / 7e-100 AT5G24910 462 / 9e-159 EUI-like p450 A1, cytochrome P450, family 714, subfamily A, polypeptide 1 (.1) Lus10025756 [exp] 173 / 4e-50 AT2G46950 578 / 0.0 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Lus10025755 [exp] 174 / 8e-49 AT1G80300 923 / 0.0 nucleotide transporter 1 (.1) Lus10010802 [exp] 160 / 1e-46 AT1G75130 432 / 6e-150 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10033044 [exp] 162 / 6e-46 AT2G26710 803 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10017771 [exp] 161 / 1e-45 AT2G26710 705 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10039234 [exp] 159 / 5e-45 AT5G52400 653 / 0.0 "cytochrome P450, family 715, subfamily A, polypeptide 1", cytochrome P450, family 715, subfamily A, polypeptide 1 (.1) Lus10026084 [exp] 159 / 6e-45 AT2G26710 375 / 6e-125 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10016310 [exp] 157 / 3e-44 AT1G75130 596 / 0.0 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) Lus10033555 [exp] 152 / 3e-42 AT5G38450 694 / 0.0 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.014G052000.4 pacid=42763350 polypeptide=Potri.014G052000.4.p locus=Potri.014G052000 ID=Potri.014G052000.4.v4.1 annot-version=v4.1 ATGTCCAGAGGGTTCATTGGGATTCCTGGCTCAAGATGGTTGTGCATATTTTTTGACGAGTGCTGGAATCCTAGTTGTGGCTTCCAAAGAAGATATATCC CTACCAAAAACAATTGGGAGATATGGAAATTGGAGAAAGAAATTAACTCAATGATATTGAAGGTTGTAAAGGAAAGGGCTGCGGCCAACTACGAGAAGGA CCTTCTGCAAATGATACTAGAGGGAGCCAAAAGTTATGGTGACCAAGAAAGCTTTCCATCAGACGTTTCTCTTGACAGGTTCATAGTGGATAACTGCAAG GCTATATACTTTGCTAGTCATGAAACCACTGCCATCACAGCTTCATGGTGCTTAATGTTATTGGCGGCTAATCAAGAATGGCAAGCTCGTGCTCGTGCGG AGGTGCTTGAAATCTGTAAAAATAACCTTCCAGATGCTGACATGCTTCGAAATATGAAAACTCTTACAATGGTGATCCAAGAGACAATGCGCCTTTATCC ACCTGTGGTGTTTGTGATCAGAAGAGCCTTGCAAGATTTAAAGTTCAAGGACATCACAATTCCAAAAGGACTGAACATCCAAATTCCAATCCCAATAGCA CAACAGAATCCTGATCAATGGAGGCCTGATGCACATCAGTTCAATCCCAAAAGATTTGCCAAAGGAATTCTAGGATCCAGCACGAGTCCATCGGATTATA TGCCATTCCGAATAGGTGCACGTATCTGTGCAGGCCAACACTTTGCCATGGCAGAGCTGAAGGTTATTGTATCACTCATCCTATCAAAGTTTAGCTTCTC GTTGTCACCAGCATACCATCATCCCCCCCGGTTTGGGCTGGTTGTGCAACCTGGCAACGGTGTTTGCCTTCATAATAGAAGAGTCTCCTGA
AA sequence Show only first row Show all	>Potri.014G052000.4 pacid=42763350 polypeptide=Potri.014G052000.4.p locus=Potri.014G052000 ID=Potri.014G052000.4.v4.1 annot-version=v4.1 MSRGFIGIPGSRWLCIFFDECWNPSCGFQRRYIPTKNNWEIWKLEKEINSMILKVVKERAAANYEKDLLQMILEGAKSYGDQESFPSDVSLDRFIVDNCK AIYFASHETTAITASWCLMLLAANQEWQARARAEVLEICKNNLPDADMLRNMKTLTMVIQETMRLYPPVVFVIRRALQDLKFKDITIPKGLNIQIPIPIA QQNPDQWRPDAHQFNPKRFAKGILGSSTSPSDYMPFRIGARICAGQHFAMAELKVIVSLILSKFSFSLSPAYHHPPRFGLVVQPGNGVCLHNRRVS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G24910		ELA1, CYP714A1	EUI-like p450 A1, cytochrome P...		Potri.014G052000 [exp]	0	1
					Potri.014G179200 [exp]	9.94	0.9061
AT2G42920			Pentatricopeptide repeat (PPR-...		Potri.005G202600 [exp]	11.74	0.9103
AT1G69523			S-adenosyl-L-methionine-depend...		Potri.008G088500 [exp]	12.80	0.9074
AT5G10910			mraW methylase family protein ...		Potri.005G179700 [exp]	20.49	0.9016
AT5G59750			DHBP synthase RibB-like alpha/...		Potri.001G234900 [exp]	37.97	0.8974
ATCG00020		ATCG00020.1, PS...	photosystem II reaction center...		Potri.013G138300 [exp]	48.34	0.8535
AT3G01920			DHBP synthase RibB-like alpha/...		Potri.001G330100 [exp]	61.04	0.8621
AT1G10657			Plant protein 1589 of unknown ...		Potri.008G189100 [exp]	84.24	0.8717
AT1G80480		PTAC17	plastid transcriptionally acti...		Potri.001G201400 [exp]	116.63	0.8638
AT2G47890	CO	COL13	B-box type zinc finger protein...		Potri.002G208100 [exp]	121.67	0.8349

Compare expression of checked genes

Potri.014G052000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.