Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44670 88 / 2e-24 Protein of unknown function (DUF581) (.1) AT5G47060 82 / 3e-21 Protein of unknown function (DUF581) (.1) AT4G17670 79 / 6e-20 Protein of unknown function (DUF581) (.1) AT5G65040 57 / 6e-12 Protein of unknown function (DUF581) (.1) AT1G78020 57 / 2e-11 Protein of unknown function (DUF581) (.1) AT1G22160 56 / 4e-11 Protein of unknown function (DUF581) (.1) AT1G53903 55 / 6e-11 Protein of unknown function (DUF581) (.1) AT1G53885 55 / 6e-11 Protein of unknown function (DUF581) (.1) AT5G49120 54 / 2e-10 Protein of unknown function (DUF581) (.1) AT3G63210 52 / 3e-09 MARD1 MEDIATOR OF ABA-REGULATED DORMANCY 1, Protein of unknown function (DUF581) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G140300 [exp] 121 / 2e-37 AT2G44670 85 / 3e-23 Protein of unknown function (DUF581) (.1) Potri.001G148700 [exp] 89 / 5e-24 AT4G17670 142 / 5e-44 Protein of unknown function (DUF581) (.1) Potri.003G085700 [exp] 86 / 7e-23 AT4G17670 140 / 2e-43 Protein of unknown function (DUF581) (.1) Potri.005G168900 [exp] 59 / 1e-12 AT1G22160 142 / 2e-44 Protein of unknown function (DUF581) (.1) Potri.002G092900 [exp] 59 / 2e-12 AT1G22160 137 / 5e-42 Protein of unknown function (DUF581) (.1) Potri.005G078600 [exp] 57 / 2e-11 AT1G78020 106 / 3e-29 Protein of unknown function (DUF581) (.1) Potri.007G089200 [exp] 56 / 4e-11 AT1G78020 120 / 8e-35 Protein of unknown function (DUF581) (.1) Potri.003G071900 [exp] 54 / 2e-10 AT1G53903 108 / 4e-31 Protein of unknown function (DUF581) (.1) Potri.008G219800 [exp] 52 / 8e-10 AT5G49120 104 / 4e-29 Protein of unknown function (DUF581) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019494 [exp] 91 / 3e-25 AT5G47060 95 / 8e-26 Protein of unknown function (DUF581) (.1) Lus10019672 [exp] 60 / 1e-12 AT1G78020 100 / 2e-27 Protein of unknown function (DUF581) (.1) Lus10000693 [exp] 60 / 2e-12 AT1G78020 99 / 6e-27 Protein of unknown function (DUF581) (.1) Lus10043343 [exp] 52 / 2e-10 AT5G47060 61 / 4e-13 Protein of unknown function (DUF581) (.1) Lus10022073 [exp] 52 / 9e-10 AT3G63210 59 / 5e-11 MEDIATOR OF ABA-REGULATED DORMANCY 1, Protein of unknown function (DUF581) (.1) Lus10037493 [exp] 49 / 2e-08 AT5G49120 83 / 1e-20 Protein of unknown function (DUF581) (.1) Lus10012417 [exp] 50 / 3e-08 AT3G22550 140 / 4e-38 Protein of unknown function (DUF581) (.1) Lus10006102 [exp] 50 / 3e-08 AT3G22550 193 / 1e-60 Protein of unknown function (DUF581) (.1) Lus10010568 [exp] 49 / 3e-08 AT3G22550 187 / 2e-58 Protein of unknown function (DUF581) (.1) Lus10027595 [exp] 48 / 8e-08 AT5G20700 76 / 1e-16 Protein of unknown function (DUF581) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0175 [poplar] [flax] TRASH PF04570 [poplar] [flax] zf-FLZ zinc-finger of the FCS-type, C2-C2
Representative CDS sequence Show only first row Show all	>Potri.014G052900.1 pacid=42763194 polypeptide=Potri.014G052900.1.p locus=Potri.014G052900 ID=Potri.014G052900.1.v4.1 annot-version=v4.1 ATGTCTTACTACAGTGGTTGCTTGGATTCCCACAAGCCTCACTTTCTTGAAGCTTGTTTTCTCTGCCGGAAAACCCTCGGTCGCAACTCCGACATCTACA TGTACAGAGGGAACACACCATTCTGTAGCAAGGAGTGCAGGCAAGAACAAATAGAGATAGATCAATCTACGGAGAAGAAGAGCTGGAAAATGTCATCCTC CTCTTCTAGATCTGTCAGAAAATCAGATCCTAAGGATTCTACCCCTAACAAGACTGTACGGACGGGCACAGTTGCTGTTGCTTAA
AA sequence Show only first row Show all	>Potri.014G052900.1 pacid=42763194 polypeptide=Potri.014G052900.1.p locus=Potri.014G052900 ID=Potri.014G052900.1.v4.1 annot-version=v4.1 MSYYSGCLDSHKPHFLEACFLCRKTLGRNSDIYMYRGNTPFCSKECRQEQIEIDQSTEKKSWKMSSSSSRSVRKSDPKDSTPNKTVRTGTVAVA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G44670			Protein of unknown function (D...		Potri.014G052900 [exp]	0	1
AT3G02150	TCP	TFPD, PTF1, TCP...	TEOSINTE BRANCHED1, CYCLOIDEA ...		Potri.017G094800 [exp]	10.14	0.8917
AT5G62680			Major facilitator superfamily ...		Potri.001G351200 [exp]	12.80	0.8916
AT4G34630			unknown protein		Potri.009G121700 [exp]	18.33	0.8584
AT4G17940			Tetratricopeptide repeat (TPR)...		Potri.002G256900 [exp]	19.89	0.8704
AT3G54680			proteophosphoglycan-related (....		Potri.013G120700 [exp]	25.21	0.8618
					Potri.005G205000 [exp]	26.73	0.8603
AT1G79160			unknown protein		Potri.011G153600 [exp]	35.63	0.8628
AT2G45330		TRPT, EMB1067	2' tRNA phosphotransferase, em...		Potri.002G117000 [exp]	45.05	0.8492
AT3G53160		UGT73C7	UDP-glucosyl transferase 73C7 ...		Potri.001G133100 [exp]	45.71	0.8449
AT5G13770			Pentatricopeptide repeat (PPR-...		Potri.008G142900 [exp]	49.63	0.8602

Compare expression of checked genes

Potri.014G052900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.