Potri.014G057550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15351 74 / 1e-17 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G142000 124 / 8e-37 AT3G15351 189 / 4e-62 unknown protein
Potri.002G142100 123 / 2e-36 AT3G15351 187 / 1e-61 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015973 89 / 4e-23 AT3G15351 228 / 1e-77 unknown protein
Lus10000852 47 / 1e-06 AT3G11980 181 / 9e-52 MALE STERILITY 2, FATTY ACID REDUCTASE 2, Jojoba acyl CoA reductase-related male sterility protein (.1)
PFAM info
Representative CDS sequence
>Potri.014G057550.1 pacid=42764213 polypeptide=Potri.014G057550.1.p locus=Potri.014G057550 ID=Potri.014G057550.1.v4.1 annot-version=v4.1
ATGGATGAAGGAATGCAGCAATTCCAACAAAGCTTAGTCGAGCTCGAAAAATGTTGCCCAACATGTCTTATTAGCTCGCAATCAGAGAGGAATGGAAACC
GAGAAGCATTGACTGCATTACGGAAGAGAGCTAAGACTACAAAAACTAGCATAAAGTCTCCGTTTGAGTCTATAATGAAAACTTTTAGTCTACTAAACTT
TTCTTCCAGCAAGCGTCAATGGCAATTCCTTGAATCTCGTGTTTACTGTGATGCAGATCAAGAACAGCTTGAATATGAAGCAAAAAATCTGCAAAGCTTT
GTAAGGGAAAAGTCCCTTCTAATTTCAGAAAAAGGTGTGCTTGCTGACAGTATTAGCCAGCGTTTGCTCAGGTCCTCAGTAACCTTAACAGACAAACCAA
AGTGA
AA sequence
>Potri.014G057550.1 pacid=42764213 polypeptide=Potri.014G057550.1.p locus=Potri.014G057550 ID=Potri.014G057550.1.v4.1 annot-version=v4.1
MDEGMQQFQQSLVELEKCCPTCLISSQSERNGNREALTALRKRAKTTKTSIKSPFESIMKTFSLLNFSSSKRQWQFLESRVYCDADQEQLEYEAKNLQSF
VREKSLLISEKGVLADSISQRLLRSSVTLTDKPK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G15351 unknown protein Potri.014G057550 0 1
AT1G04400 FHA, AT-PHH1, C... cryptochrome 2 (.1.2) Potri.008G166632 2.00 0.8081
AT1G27410 DNA repair metallo-beta-lactam... Potri.013G121101 4.00 0.7209
AT3G01720 unknown protein Potri.001G336400 8.12 0.7739
AT1G15780 unknown protein Potri.003G028089 12.64 0.7812
AT1G02335 GL22 germin-like protein subfamily ... Potri.008G084300 15.49 0.6882
AT5G09860 AtTHO1, AtHPR1 nuclear matrix protein-related... Potri.001G031700 16.58 0.7451
AT1G53040 Protein of unknown function (D... Potri.011G119300 23.68 0.7320
AT1G63700 EMB71, MAPKKK4,... YODA, MAP KINASE KINASE KINASE... Potri.001G102900 29.46 0.7429
AT3G53270 Small nuclear RNA activating c... Potri.004G126720 32.71 0.7328
AT3G24600 Late embryogenesis abundant pr... Potri.006G160100 38.06 0.6828

Potri.014G057550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.