Potri.014G057850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.014G057850.1 pacid=42763050 polypeptide=Potri.014G057850.1.p locus=Potri.014G057850 ID=Potri.014G057850.1.v4.1 annot-version=v4.1
ATGGTAAATCGGTCACCATTTAACACAGTTTATGCAACCTTGTTGTTTAAGAAACCGCAGCTAGCAACAAGAAGAAGATACGCGGCCTTAGGATGGATTG
AAACACTGCCCCCCACGATAAACCTTAAAAATCTGATCCTTCAGAGAATTGAAGTTAAAGACAAGCTACGATTAGTACTTGTAGGTTGTGTTTTATTTTT
TGGTGCTAAAATAGAGGTTGTAATGGCAACATCTCAAGAGATTTGTCATGCGTGTAATTTAAACATAACCCAGTTGTACATCTTGTTAAAAAAAGAATCC
AATTATGTATCAAATGTATGCTCATGTTTCTTTAATTTAATTGCTTAG
AA sequence
>Potri.014G057850.1 pacid=42763050 polypeptide=Potri.014G057850.1.p locus=Potri.014G057850 ID=Potri.014G057850.1.v4.1 annot-version=v4.1
MVNRSPFNTVYATLLFKKPQLATRRRYAALGWIETLPPTINLKNLILQRIEVKDKLRLVLVGCVLFFGAKIEVVMATSQEICHACNLNITQLYILLKKES
NYVSNVCSCFFNLIA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.014G057850 0 1
AT3G05950 RmlC-like cupins superfamily p... Potri.019G026200 5.65 0.8897
AT2G36540 Haloacid dehalogenase-like hyd... Potri.010G244200 5.65 0.8763
AT2G18370 Bifunctional inhibitor/lipid-t... Potri.001G232900 10.24 0.8843
AT5G42830 HXXXD-type acyl-transferase fa... Potri.014G025600 13.60 0.8724
AT4G34350 HDR, CLB6, ISPH CHLOROPLAST BIOGENESIS 6, 4-hy... Potri.004G150400 18.97 0.8662 Pt-CLB6.1
AT1G31320 AS2 LBD4 LOB domain-containing protein ... Potri.005G097800 19.07 0.8140
AT2G22540 MADS AGL22, SVP SHORT VEGETATIVE PHASE, AGAMOU... Potri.007G115100 19.77 0.8513
AT3G18670 Ankyrin repeat family protein ... Potri.015G119800 21.21 0.8538
AT5G60900 RLK1 receptor-like protein kinase 1... Potri.007G111200 22.62 0.8519
AT2G22540 MADS AGL22, SVP SHORT VEGETATIVE PHASE, AGAMOU... Potri.007G115200 24.67 0.8686 MADS1.5

Potri.014G057850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.