Potri.014G058400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G00030 281 / 3e-97 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT5G09820 47 / 4e-06 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
AT3G23400 40 / 0.0008 FIB4 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G020700 56 / 2e-09 AT3G26070 244 / 6e-81 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.001G309300 47 / 3e-06 AT5G09820 268 / 7e-90 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020912 284 / 8e-98 AT4G00030 276 / 2e-94 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10033514 52 / 8e-08 AT5G09820 270 / 3e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Lus10020860 51 / 1e-07 AT5G09820 269 / 5e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04755 PAP_fibrillin PAP_fibrillin
Representative CDS sequence
>Potri.014G058400.1 pacid=42762705 polypeptide=Potri.014G058400.1.p locus=Potri.014G058400 ID=Potri.014G058400.1.v4.1 annot-version=v4.1
ATGGCCACATGTCATTGCCTCCTTCTCCCAGTTCCCTTCAAACCTACCATTATCCCTCCTAAACCCATCTCCAAAATCACCTGCTCGTCAATCACAACCC
AGTCACAATCAGCCAAGCAACACCTCCTTACTCTAATCTCCGATCAACACCGTGGCCTCAAAACCCAAAATGATCCCATTAAAAGATCCTCAATTATCCA
AGCCATTGATGCAATGGCTGATCTAGGAAAAGATACAGTCACCACTGATGACTCACTTTCTGCCACTTGGCGGTTGCTTTGGACCACAGAGAAAGAGCAG
CTTTTTATCATAGAGAAAGCTCCATTGTTTGGTACTCAAGCTGGTGATGTTTTGCAGGTTATAGATGTTGAAAAAAGGACTCTTAATAATGTTATCACTT
TTCCACCTGATGGGGTTTTCTTTGTACGCTCAAGTATTGAAGTTTCTTCCTCTCAAAGAGTGAATTTTAGATTTACAAGTGCGGTTTTAAGAGGGAAGAA
TTGGGAGATACCGTTGCCGCCTTTCGGCCAGGGATGGTTTGAATCGTTGTACATTGATGAGGAGATTAGAGTAGTGAAGGATATCAGGGGAGATTATTTA
GTTGTTGACAAAGCTCCTTATGCTTGGAAAGAATGA
AA sequence
>Potri.014G058400.1 pacid=42762705 polypeptide=Potri.014G058400.1.p locus=Potri.014G058400 ID=Potri.014G058400.1.v4.1 annot-version=v4.1
MATCHCLLLPVPFKPTIIPPKPISKITCSSITTQSQSAKQHLLTLISDQHRGLKTQNDPIKRSSIIQAIDAMADLGKDTVTTDDSLSATWRLLWTTEKEQ
LFIIEKAPLFGTQAGDVLQVIDVEKRTLNNVITFPPDGVFFVRSSIEVSSSQRVNFRFTSAVLRGKNWEIPLPPFGQGWFESLYIDEEIRVVKDIRGDYL
VVDKAPYAWKE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G00030 Plastid-lipid associated prote... Potri.014G058400 0 1
AT5G10600 CYP81K2 "cytochrome P450, family 81, s... Potri.014G021400 6.92 0.9513 Pt-IFS1.54
AT3G62410 CP12-2 CP12 DOMAIN-CONTAINING PROTEIN... Potri.002G196100 7.21 0.9657
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Potri.010G073166 7.48 0.9575
AT1G10500 ATCPISCA chloroplast-localized ISCA-lik... Potri.005G085400 7.74 0.9632
AT1G06690 NAD(P)-linked oxidoreductase s... Potri.002G055500 8.48 0.9606
AT3G20230 Ribosomal L18p/L5e family prot... Potri.013G108700 11.87 0.9620
AT3G62410 CP12-2 CP12 DOMAIN-CONTAINING PROTEIN... Potri.014G120700 12.24 0.9592
AT2G35260 unknown protein Potri.001G143400 15.55 0.9531
AT3G21790 UDP-Glycosyltransferase superf... Potri.006G007350 16.70 0.9552
AT5G22620 phosphoglycerate/bisphosphogly... Potri.004G187700 19.87 0.9597

Potri.014G058400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.