Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60530 189 / 7e-60 GATA GATA4 GATA transcription factor 4 (.1) AT2G45050 187 / 6e-59 GATA GATA2 GATA transcription factor 2 (.1) AT4G32890 166 / 6e-50 GATA GATA9 GATA transcription factor 9 (.1) AT5G25830 152 / 1e-44 GATA GATA12 GATA transcription factor 12 (.1) AT4G36240 132 / 7e-38 GATA GATA7 GATA transcription factor 7 (.1) AT4G34680 125 / 1e-34 GATA GATA3 GATA transcription factor 3 (.1.2) AT1G08010 125 / 2e-34 GATA GATA11 GATA transcription factor 11 (.1.2) AT3G24050 123 / 9e-34 GATA GATA1 GATA transcription factor 1 (.1) AT1G08000 120 / 2e-32 GATA GATA10 GATA transcription factor 10 (.1.2) AT5G66320 120 / 3e-32 GATA GATA5 GATA transcription factor 5 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G142800 [exp] 287 / 2e-98 AT3G60530 189 / 1e-59 GATA transcription factor 4 (.1) Potri.001G188500 [exp] 160 / 9e-48 AT4G32890 201 / 7e-63 GATA transcription factor 9 (.1) Potri.006G237700 [exp] 149 / 6e-43 AT5G25830 246 / 2e-79 GATA transcription factor 12 (.1) Potri.018G044900 [exp] 149 / 1e-42 AT5G25830 247 / 2e-79 GATA transcription factor 12 (.1) Potri.001G053500 [exp] 126 / 4e-35 AT3G24050 171 / 4e-52 GATA transcription factor 1 (.1) Potri.009G123400 [exp] 127 / 1e-34 AT5G66320 179 / 8e-54 GATA transcription factor 5 (.1.2) Potri.003G174800 [exp] 125 / 1e-34 AT3G24050 167 / 6e-51 GATA transcription factor 1 (.1) Potri.004G211800 [exp] 125 / 2e-34 AT1G08010 150 / 4e-43 GATA transcription factor 11 (.1.2) Potri.004G161500 [exp] 125 / 3e-34 AT5G66320 178 / 2e-53 GATA transcription factor 5 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028178 [exp] 201 / 5e-64 AT2G45050 204 / 3e-65 GATA transcription factor 2 (.1) Lus10038273 [exp] 164 / 6e-49 AT4G32890 219 / 1e-69 GATA transcription factor 9 (.1) Lus10037572 [exp] 161 / 5e-48 AT4G32890 236 / 2e-76 GATA transcription factor 9 (.1) Lus10011430 [exp] 160 / 1e-47 AT4G32890 237 / 9e-77 GATA transcription factor 9 (.1) Lus10025829 [exp] 154 / 3e-45 AT4G32890 221 / 2e-70 GATA transcription factor 9 (.1) Lus10023684 [exp] 130 / 2e-37 AT3G24050 168 / 3e-52 GATA transcription factor 1 (.1) Lus10042879 [exp] 128 / 4e-36 AT2G45050 147 / 1e-43 GATA transcription factor 2 (.1) Lus10011762 [exp] 126 / 3e-35 AT3G24050 174 / 1e-53 GATA transcription factor 1 (.1) Lus10031096 [exp] 118 / 1e-33 AT5G66320 137 / 1e-40 GATA transcription factor 5 (.1.2) Lus10037398 [exp] 120 / 1e-32 AT1G08010 169 / 1e-50 GATA transcription factor 11 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [poplar] [flax] Zn_Beta_Ribbon PF00320 [poplar] [flax] GATA GATA zinc finger
Representative CDS sequence Show only first row Show all	>Potri.014G058600.1 pacid=42764772 polypeptide=Potri.014G058600.1.p locus=Potri.014G058600 ID=Potri.014G058600.1.v4.1 annot-version=v4.1 ATGGATGTCTATGGAGGATTGTCTACCACCACTGCACCTGATTATTTCCACATTGATGACCTTTTAGACTTCTCTAATGACGACCTCCTCTCCTCACCCT CCTCCTCCATCGACCACCACCACCACCTTCCTCCACCTGAAACCTCCTCCATTCATCACCACCACTTCCCCTCCTCCACCTATATTAATAACCCTTCTTC TCTCTCCACTGACTTCACTGACCATCTCTCAGTCCCAACCGATGACGTGGCAGAGCTAGAGTGGCTATCGCAATTCGTGGAGGACTCGTTCTCCGACTTT CCGAGCATCATTAATATCCCAACCGACACGTCGTTTTGCAACAAATCTCGCAGCAAACGCTCACGAGCCACCGCCACCACCGCGACGTCCTCCTCGCCGG AGCTCGAAACTGCGGTGACCGGAAAATCGAGATTGAAGAAGGAAAACAACGGAGCGCCGCATTCTCCGGCGGAGGAGGGGACAGTGCGGAGGTGCACGCA CTGCGCGTCTGAGAAGACTCCTCAGTGGAGGACGGGTCCGCTGGGTCCAAAAACGCTATGCAATGCCTGTGGAGTCAGGTATAAGTCGGGTCGGCTTGTA CCAGAATATCGACCCGCAGCGAGTCCGACTTTTGTGTTGACTCGGCATTCGAACTCGCACCGTAAAGTTTTGGAGCTCCGAAGACAGAAAGAGATGACGG TGGGGCGGCAGCAGCAGCAGCAGCAGCACGGTTACCAAGGCTATGAAGTTTGCTAA
AA sequence Show only first row Show all	>Potri.014G058600.1 pacid=42764772 polypeptide=Potri.014G058600.1.p locus=Potri.014G058600 ID=Potri.014G058600.1.v4.1 annot-version=v4.1 MDVYGGLSTTTAPDYFHIDDLLDFSNDDLLSSPSSSIDHHHHLPPPETSSIHHHHFPSSTYINNPSSLSTDFTDHLSVPTDDVAELEWLSQFVEDSFSDF PSIINIPTDTSFCNKSRSKRSRATATTATSSSPELETAVTGKSRLKKENNGAPHSPAEEGTVRRCTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRLV PEYRPAASPTFVLTRHSNSHRKVLELRRQKEMTVGRQQQQQQHGYQGYEVC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G60530	GATA	GATA4	GATA transcription factor 4 (....		Potri.014G058600 [exp]	0	1
AT2G18550	HD	HB-2, ATHB21	homeobox-2, homeobox protein 2...		Potri.005G126100 [exp]	1.00	0.9614
					Potri.018G122600 [exp]	7.74	0.9375
AT5G07010		ATST2A	ARABIDOPSIS THALIANA SULFOTRAN...		Potri.001G036600 [exp]	8.66	0.9372
AT2G23620		ATMES1	ARABIDOPSIS THALIANA METHYL ES...		Potri.007G037300 [exp]	9.89	0.9283
AT3G49690	MYB	ATMYB84, RAX3	REGULATOR OF AXILLARY MERISTEM...		Potri.018G058800 [exp]	10.39	0.9247
					Potri.002G101101 [exp]	10.48	0.9233
AT5G50400		ATPAP27, PAP27	ARABIDOPSIS THALIANA PURPLE AC...		Potri.001G023400 [exp]	12.24	0.9043
AT5G54370			Late embryogenesis abundant (L...		Potri.012G145400 [exp]	12.96	0.9260
AT2G14900			Gibberellin-regulated family p...		Potri.007G051300 [exp]	13.67	0.9154
					Potri.018G119300 [exp]	13.85	0.9159

Compare expression of checked genes

Potri.014G058600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.