Potri.014G065600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G061500 271 / 2e-94 ND /
Potri.014G065250 259 / 4e-90 ND /
Potri.014G065900 250 / 3e-86 ND /
Potri.014G061800 239 / 4e-82 ND /
Potri.014G065100 213 / 8e-72 ND /
Potri.014G065200 181 / 1e-58 ND /
Potri.014G065300 178 / 9e-58 ND /
Potri.001G407500 175 / 1e-56 ND /
Potri.001G407401 174 / 4e-56 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.014G065600.1 pacid=42764167 polypeptide=Potri.014G065600.1.p locus=Potri.014G065600 ID=Potri.014G065600.1.v4.1 annot-version=v4.1
ATGGAGCAGAGCATAATGGCTGAAAACCACAGGCCAAATCCTGCTTTCGAAAAAGAAAGCATTATTATGCAACATGGAATATTTGCCCTCCTGGTTGGGA
CGCTAAACAATCAAATCCAAGTGAAGTACCAGTCAATTAAAGGCTCTCCATTCGACAGCCACGACGTTATTATGTCAGTTTTCCTTGTTGCTCTGTTTAT
ATATGCCACGGCATCGGTGGCCGAAGTTATGCTCCGAGCTCGAGAATCAACTTACTACACACTGGTTGGCAATCTCCGACTCTTTGCCAGTGCCCTCGCT
GCGATATTGCTTCTAGCTATTCTGGCTCCAATTCTGGGGTGCGTTATTTCGGTCGTATGGGCCTGTTTATTTATCGGAGTTGCATATGAATCAAGCCGAG
AGTTGTCCAACATTTTAAGCCAGTTAACCACCAATAAGTTACTTGACATGTTGACCAGGCTAATTGCACGCGCAAGGAGTCGCAAGGAGGAACCAAATCA
GCCACATGTCTAG
AA sequence
>Potri.014G065600.1 pacid=42764167 polypeptide=Potri.014G065600.1.p locus=Potri.014G065600 ID=Potri.014G065600.1.v4.1 annot-version=v4.1
MEQSIMAENHRPNPAFEKESIIMQHGIFALLVGTLNNQIQVKYQSIKGSPFDSHDVIMSVFLVALFIYATASVAEVMLRARESTYYTLVGNLRLFASALA
AILLLAILAPILGCVISVVWACLFIGVAYESSRELSNILSQLTTNKLLDMLTRLIARARSRKEEPNQPHV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.014G065600 0 1
AT5G57620 MYB ATMYB36 myb domain protein 36 (.1) Potri.016G099200 3.87 0.9465
AT1G75130 CYP721A1 "cytochrome P450, family 721, ... Potri.002G134500 4.69 0.9342 CYP721.5
AT4G27290 S-locus lectin protein kinase ... Potri.011G125601 10.24 0.9300
AT5G51790 bHLH bHLH120 basic helix-loop-helix (bHLH) ... Potri.012G132000 11.13 0.9306
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Potri.003G007900 12.00 0.9285
AT1G52140 unknown protein Potri.001G188900 14.07 0.9247
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Potri.001G025200 14.45 0.9200
AT4G35160 O-methyltransferase family pro... Potri.009G139800 14.49 0.9164
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Potri.014G037700 14.49 0.9262
AT3G57230 MADS AGL16 AGAMOUS-like 16 (.1.2) Potri.002G109601 14.83 0.9210

Potri.014G065600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.