Potri.014G065700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G061700 170 / 1e-55 ND /
Potri.014G065200 171 / 6e-55 ND /
Potri.014G065000 167 / 1e-54 ND /
Potri.014G065300 167 / 1e-53 ND /
Potri.014G064900 166 / 3e-53 ND /
Potri.014G063350 166 / 3e-53 ND /
Potri.014G061600 163 / 4e-52 ND /
Potri.014G065600 153 / 4e-48 ND /
Potri.014G065250 149 / 1e-46 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.014G065700.1 pacid=42763028 polypeptide=Potri.014G065700.1.p locus=Potri.014G065700 ID=Potri.014G065700.1.v4.1 annot-version=v4.1
ATGGCTGCAAACCATAGGCCAGATCTTGGGTTCGAGAGAGACAGCATCGTTGTGCATCATGGAGTCTTCGCTATGCTCGTGGACACATTAAATAAACAAA
TCCAAGTGAAATATCAATCAATGCCTATTTCTCCATACGATACTCACAAGAGGGTCATGTCAGCGTTTTTGGCCGCTCTATTTATATACGCCACAGCATC
GGTGGCCGAGGCGATACCGCGGAGCCAGGAATCAGTTTACCAGAGGCTTTTCGGCAAGATCCGCCTCTTTGCAAGCGCCCTTGCTACAGTTTTCCTTCTG
GTGCTTCTAACCCCACCTTGGGGGTACTCTATCATTTCTATTCTGTGGATTTGTTTATTGGTGTCACTAGCATATGAATCATGTCAACAATTCTACCAAT
TGCTAAGCCAAGCATATACTGACATGCTGGAAAAGCTATTTGATGGTGAGAGGAGCCGTGAAGAGGACCCAAGCTAG
AA sequence
>Potri.014G065700.1 pacid=42763028 polypeptide=Potri.014G065700.1.p locus=Potri.014G065700 ID=Potri.014G065700.1.v4.1 annot-version=v4.1
MAANHRPDLGFERDSIVVHHGVFAMLVDTLNKQIQVKYQSMPISPYDTHKRVMSAFLAALFIYATASVAEAIPRSQESVYQRLFGKIRLFASALATVFLL
VLLTPPWGYSIISILWICLLVSLAYESCQQFYQLLSQAYTDMLEKLFDGERSREEDPS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.014G065700 0 1
Potri.001G259224 3.74 0.9785
AT1G52540 Protein kinase superfamily pro... Potri.006G173800 4.89 0.9738
Potri.016G020750 7.07 0.9653
Potri.002G112400 9.79 0.9615
Potri.012G008845 10.19 0.9659
AT5G36930 Disease resistance protein (TI... Potri.006G269950 10.58 0.9365
Potri.012G007866 11.22 0.9659
AT3G62040 Haloacid dehalogenase-like hyd... Potri.002G185300 13.96 0.9621
AT3G09780 CCR1, ATCRR1 CRINKLY4 related 1 (.1) Potri.006G128350 16.97 0.9320
AT5G05460 AtENGase85A Endo-beta-N-acetyglucosaminida... Potri.008G072901 17.32 0.9251

Potri.014G065700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.