Potri.014G066400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60550 343 / 3e-121 CYCP3;2 cyclin p3;2 (.1)
AT2G45080 341 / 2e-120 CYCP3;1 cyclin p3;1 (.1)
AT2G44740 153 / 1e-46 CYCP4;1 cyclin p4;1 (.1)
AT5G61650 147 / 5e-44 CYCP4;2 CYCLIN P4;2 (.1)
AT5G07450 145 / 3e-43 CYCP4;3 cyclin p4;3 (.1)
AT3G21870 130 / 9e-38 CYCP2;1 cyclin p2;1 (.1)
AT3G63120 124 / 5e-35 CYCP1;1 cyclin p1;1 (.1)
AT3G05327 116 / 5e-32 Cyclin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G143400 442 / 2e-160 AT2G45080 324 / 1e-113 cyclin p3;1 (.1)
Potri.007G121500 157 / 4e-48 AT3G21870 228 / 5e-76 cyclin p2;1 (.1)
Potri.014G050400 148 / 8e-45 AT2G44740 285 / 8e-99 cyclin p4;1 (.1)
Potri.002G052800 147 / 1e-43 AT3G63120 219 / 1e-71 cyclin p1;1 (.1)
Potri.005G209800 145 / 1e-43 AT3G63120 223 / 7e-74 cyclin p1;1 (.1)
Potri.012G114600 145 / 2e-43 AT2G44740 277 / 2e-95 cyclin p4;1 (.1)
Potri.013G023000 144 / 2e-43 AT3G05327 194 / 4e-63 Cyclin family protein (.1)
Potri.015G112140 144 / 4e-43 AT2G44740 274 / 1e-94 cyclin p4;1 (.1)
Potri.005G033600 137 / 2e-40 AT3G05327 184 / 5e-59 Cyclin family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042873 310 / 4e-108 AT3G60550 300 / 8e-104 cyclin p3;2 (.1)
Lus10028174 259 / 9e-89 AT2G45080 249 / 1e-84 cyclin p3;1 (.1)
Lus10022038 151 / 2e-45 AT3G63120 197 / 8e-64 cyclin p1;1 (.1)
Lus10042582 145 / 2e-43 AT3G63120 191 / 2e-61 cyclin p1;1 (.1)
Lus10004475 144 / 4e-43 AT3G05327 171 / 1e-53 Cyclin family protein (.1)
Lus10027148 144 / 3e-42 AT3G21870 233 / 6e-77 cyclin p2;1 (.1)
Lus10029933 139 / 4e-41 AT3G05327 172 / 3e-54 Cyclin family protein (.1)
Lus10039697 140 / 5e-41 AT3G21870 236 / 3e-79 cyclin p2;1 (.1)
Lus10032505 139 / 1e-40 AT2G44740 228 / 7e-76 cyclin p4;1 (.1)
Lus10043003 137 / 1e-39 AT2G44740 227 / 2e-75 cyclin p4;1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0065 Cyclin PF00134 Cyclin_N Cyclin, N-terminal domain
Representative CDS sequence
>Potri.014G066400.1 pacid=42762955 polypeptide=Potri.014G066400.1.p locus=Potri.014G066400 ID=Potri.014G066400.1.v4.1 annot-version=v4.1
ATGGCTACATCTTCTCTTGCAATTTCCCCAAGAAAACTCCGATCTGATCTGTATTCCTATTCCTACCAAAATGACTCAAACACCCCACTAGTCATTGCTG
TTCTTGCTTCTCTTATTGAGAGAACCATGGCAAGGAATGAAAGAATTGTCAAGAACTGCACTTGGGCTTTATCTAAAGATACCAGAACTCGAGTCTTTGA
TTGCCACGAGACACCAGACTTGACAATTCAATCGTATCTTGAGAGAATTTTTCGATACACTCGTGCAGGACCTTCAGTTTATGTTGTTGCCTATGTTTAC
ATTGATCGGTTTTGTCAGGCTAATCCAGAGTTTAGAATCAACGCAAGAAATGTACATAGGCTTCTTATTACTACTATCATGGTGGCTTCTAAATACGTTG
AGGACATGAATTACAGGAATTCTTATTTTGCAAGAGTTGGGGGATTGACAGCAAATGTAATGAACAAGATGGAGCTTGAATTCTTGTTCTTGATGGGTTT
CAAATTGCATGTGAATGTAAGTGTTTTTGAGAGCTATTGCTGTCATTTAGAAAGGGAAGTAGGCATTGGAGGTGGATACCATATAGAGAAGACTTTGAGA
TGTGCAGAAGAAATCAAATCAAGGCAACAAGAAGAGAAAGGATATAATCAGATTGCTCGAATTATGTTGTAG
AA sequence
>Potri.014G066400.1 pacid=42762955 polypeptide=Potri.014G066400.1.p locus=Potri.014G066400 ID=Potri.014G066400.1.v4.1 annot-version=v4.1
MATSSLAISPRKLRSDLYSYSYQNDSNTPLVIAVLASLIERTMARNERIVKNCTWALSKDTRTRVFDCHETPDLTIQSYLERIFRYTRAGPSVYVVAYVY
IDRFCQANPEFRINARNVHRLLITTIMVASKYVEDMNYRNSYFARVGGLTANVMNKMELEFLFLMGFKLHVNVSVFESYCCHLEREVGIGGGYHIEKTLR
CAEEIKSRQQEEKGYNQIARIML

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G60550 CYCP3;2 cyclin p3;2 (.1) Potri.014G066400 0 1
AT2G36570 Leucine-rich repeat protein ki... Potri.006G117200 3.60 0.9400
AT5G57330 Galactose mutarotase-like supe... Potri.001G037700 4.47 0.9339
AT2G34770 ATFAH1, FAH1 ARABIDOPSIS FATTY ACID HYDROXY... Potri.011G162000 6.92 0.9257 Pt-FAH1.1
AT5G01580 OSH1 OAS HIGH ACCUMULATION 1, gamma... Potri.016G121900 7.34 0.9183
AT4G21450 PapD-like superfamily protein ... Potri.013G147800 8.36 0.9195
AT3G56810 unknown protein Potri.006G026600 9.16 0.9214
AT1G79760 DTA4 downstream target of AGL15-4 (... Potri.001G189400 10.39 0.8990 DTA4.1
AT1G07220 Arabidopsis thaliana protein o... Potri.001G252000 11.40 0.9127
AT3G55770 LIM WLIM2b WLIM2b, GATA type zinc finger ... Potri.010G193800 11.48 0.9141
AT4G33945 ARM repeat superfamily protein... Potri.009G106100 12.24 0.9111

Potri.014G066400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.