Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60690 191 / 8e-63 SAUR-like auxin-responsive protein family (.1) AT2G45210 168 / 5e-54 SAUR-like auxin-responsive protein family (.1) AT4G12410 132 / 1e-39 SAUR-like auxin-responsive protein family (.1) AT4G22620 129 / 1e-38 SAUR-like auxin-responsive protein family (.1) AT3G61900 87 / 2e-22 SAUR-like auxin-responsive protein family (.1) AT2G46690 87 / 2e-22 SAUR-like auxin-responsive protein family (.1) AT4G00880 84 / 5e-21 SAUR-like auxin-responsive protein family (.1) AT5G53590 76 / 5e-18 SAUR-like auxin-responsive protein family (.1) AT2G21210 75 / 6e-18 SAUR-like auxin-responsive protein family (.1) AT2G21220 74 / 1e-17 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G145300 [exp] 271 / 2e-94 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1) Potri.003G113100 [exp] 152 / 1e-47 AT4G12410 149 / 1e-46 SAUR-like auxin-responsive protein family (.1) Potri.001G119900 [exp] 147 / 1e-45 AT4G12410 140 / 8e-43 SAUR-like auxin-responsive protein family (.1) Potri.014G103300 [exp] 85 / 8e-22 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.002G176400 [exp] 85 / 9e-22 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1) Potri.012G023400 [exp] 83 / 9e-21 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1) Potri.015G006800 [exp] 80 / 1e-19 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 76 / 2e-18 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.009G127500 [exp] 74 / 7e-18 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009286 [exp] 201 / 1e-66 AT3G60690 150 / 2e-46 SAUR-like auxin-responsive protein family (.1) Lus10015879 [exp] 194 / 5e-64 AT3G60690 151 / 7e-47 SAUR-like auxin-responsive protein family (.1) Lus10030295 [exp] 150 / 1e-46 AT2G45210 131 / 1e-39 SAUR-like auxin-responsive protein family (.1) Lus10024600 [exp] 110 / 8e-31 AT4G12410 149 / 3e-46 SAUR-like auxin-responsive protein family (.1) Lus10001985 [exp] 100 / 4e-27 AT2G45210 93 / 2e-24 SAUR-like auxin-responsive protein family (.1) Lus10032237 [exp] 99 / 2e-26 AT4G12410 149 / 2e-46 SAUR-like auxin-responsive protein family (.1) Lus10004337 [exp] 96 / 1e-25 AT4G12410 110 / 2e-31 SAUR-like auxin-responsive protein family (.1) Lus10028920 [exp] 94 / 2e-25 AT4G12410 106 / 1e-30 SAUR-like auxin-responsive protein family (.1) Lus10010110 [exp] 81 / 6e-20 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 77 / 4e-18 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.014G066900.1 pacid=42763514 polypeptide=Potri.014G066900.1.p locus=Potri.014G066900 ID=Potri.014G066900.1.v4.1 annot-version=v4.1 ATGAGAAAGATAAGAGGTTTCAAGATTGGCAAACGGTTAGTCCGGATCTCCACATGGATCTTCCGTCGGACCCGGATCCACCCACCGGGTTACAACCTTT TAGGCCAATCAGAATCAACATGCAGGTCCAAGCCAAAGTCCATATCGAAAATCATCAACTGGGGTCGTCGTTTAACAAAAGGAGCTAAATCACTTTGCGG TGCAAAACCAGGGTCGGGTTACATACCCATGGGTCATGAACTGGTTTGCGATAAACCGGTTACTGTACCAAAAGGGCACTTGGCTGTTTACGTTGGTCAA AAAGACGGCGACTTTCATAGAGTTTTGGTGCCTGTGATTTATTTTAATCATCCTTTGTTTGGTGAGTTATTAAGAGAAGCCGAAGAGGAATATGGGTTTA ATCAACAAGGTGGGATTACCATTCCTTGCCGATTCTCGGAGTTTGAGAGTGTCCAAACCCGTATTAAAGCTGGGTCTGGAGGGAAGCCGACGTGGAAACG TAACCACTATTGA
AA sequence Show only first row Show all	>Potri.014G066900.1 pacid=42763514 polypeptide=Potri.014G066900.1.p locus=Potri.014G066900 ID=Potri.014G066900.1.v4.1 annot-version=v4.1 MRKIRGFKIGKRLVRISTWIFRRTRIHPPGYNLLGQSESTCRSKPKSISKIINWGRRLTKGAKSLCGAKPGSGYIPMGHELVCDKPVTVPKGHLAVYVGQ KDGDFHRVLVPVIYFNHPLFGELLREAEEEYGFNQQGGITIPCRFSEFESVQTRIKAGSGGKPTWKRNHY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G60690			SAUR-like auxin-responsive pro...		Potri.014G066900 [exp]	0	1
AT3G26510			Octicosapeptide/Phox/Bem1p fam...		Potri.010G046400 [exp]	6.16	0.9386
AT5G36930			Disease resistance protein (TI...		Potri.013G098100 [exp]	7.41	0.9325
AT4G22260		IM1, IM	IMMUTANS, Alternative oxidase ...		Potri.011G021800 [exp]	8.42	0.9386
AT1G21000			PLATZ transcription factor fam...		Potri.005G259000 [exp]	9.00	0.9248
AT1G79510			Uncharacterized conserved prot...		Potri.010G173000 [exp]	9.16	0.9341
AT5G61220			LYR family of Fe/S cluster bio...		Potri.009G079800 [exp]	10.24	0.9068
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Potri.009G030700 [exp]	10.24	0.9262
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Potri.005G079600 [exp]	10.67	0.9308	Pt-ACT11.10
AT3G27320			alpha/beta-Hydrolases superfam...		Potri.008G180500 [exp]	12.00	0.9175
AT1G10500		ATCPISCA	chloroplast-localized ISCA-lik...		Potri.007G079600 [exp]	12.12	0.9364

Compare expression of checked genes

Potri.014G066900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.