Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00080 155 / 1e-47 UNE11 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62770 150 / 2e-45 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62350 128 / 6e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47380 128 / 6e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 125 / 7e-36 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G12390 119 / 2e-33 PME1 pectin methylesterase inhibitor 1 (.1) AT5G62360 110 / 6e-30 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G20740 102 / 1e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25250 98 / 3e-25 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 92 / 7e-23 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G145800 [exp] 320 / 4e-112 AT4G00080 164 / 4e-51 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127500 [exp] 148 / 1e-44 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128700 [exp] 145 / 2e-43 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113700 [exp] 129 / 3e-37 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1) Potri.015G128200 [exp] 123 / 5e-35 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128100 [exp] 118 / 7e-33 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128300 [exp] 109 / 1e-29 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127400 [exp] 105 / 5e-28 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128500 [exp] 104 / 2e-27 AT4G25250 144 / 2e-43 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030292 [exp] 177 / 1e-55 AT4G00080 158 / 1e-48 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10001988 [exp] 175 / 6e-55 AT4G00080 154 / 5e-47 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031133 [exp] 135 / 2e-39 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031713 [exp] 129 / 3e-37 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027198 [exp] 124 / 3e-35 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038914 [exp] 123 / 6e-35 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031138 [exp] 108 / 5e-29 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10032230 [exp] 108 / 5e-29 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10024593 [exp] 102 / 1e-26 AT1G62770 162 / 2e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038915 [exp] 96 / 4e-24 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.014G067500.1 pacid=42763416 polypeptide=Potri.014G067500.1.p locus=Potri.014G067500 ID=Potri.014G067500.1.v4.1 annot-version=v4.1 ATGTCCTCAACTCAGTGTTTGACATATTTCCTTTCCCTCTCAATTCTACAACCTTCAACATTAATGGCTCGTCTCAGTCTTTTCATACTGCTTCTACTAC TCTCTCTAGTTTGCATTACGGGCGCGGAGAAACCAGTTAGGTTTCCAAGACGCTCCCGGTCTCGGGCCTACATCGAAAACGCATGCACTAAGACCCTTTA TCCATCCCTGTGCATCCAATACCTATCAGTCTCTGCAAACTCAATGACAATACAAACTCCACAGCAACTAGCCCAAGCTGCCTTATCCGTGAGCCTATAC AAGGCCCTCCAAACAAGAACATTCATGTTGAAAGTGGTTAAGGAGCTCAAGGCAAGGAAATCCAAGGATTACCAAGCAGTGAAAGACTGCTTAGATCAAA TTGGTAATAGCGTGGATCAACTTAGTGAATCAGTTAGAGAGCTCCATCGCTTGGAACGCCCAGATGCTGAAGGAGGTGATAACGTCTTTTGGCACATAAG TAATGTTGAAACTTTTGTAAGCTCTGCCATGACTGATGCTAGCACTTGTTTGGATGGGTTTCCGGGGAGGAATATGAACAAGTCAAGGGCCATGATTAAG GCCAAGGTTTTGAACGTGGCTCAGACTGCTAGCAATGCATTAGCCTTGTTTCACCGGTATGCTGCAAAGTACAAGCCATAA
AA sequence Show only first row Show all	>Potri.014G067500.1 pacid=42763416 polypeptide=Potri.014G067500.1.p locus=Potri.014G067500 ID=Potri.014G067500.1.v4.1 annot-version=v4.1 MSSTQCLTYFLSLSILQPSTLMARLSLFILLLLLSLVCITGAEKPVRFPRRSRSRAYIENACTKTLYPSLCIQYLSVSANSMTIQTPQQLAQAALSVSLY KALQTRTFMLKVVKELKARKSKDYQAVKDCLDQIGNSVDQLSESVRELHRLERPDAEGGDNVFWHISNVETFVSSAMTDASTCLDGFPGRNMNKSRAMIK AKVLNVAQTASNALALFHRYAAKYKP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G00080		UNE11	unfertilized embryo sac 11, Pl...		Potri.014G067500 [exp]	0	1
AT1G06930			unknown protein		Potri.019G127400 [exp]	5.91	0.9624
AT3G12890		ASML2	activator of spomin::LUC2 (.1)		Potri.001G136700 [exp]	10.24	0.9260
					Potri.014G163733 [exp]	10.95	0.9474
AT5G05950		MEE60	maternal effect embryo arrest ...		Potri.009G038500 [exp]	12.00	0.9120
AT5G11390		WIT1	WPP domain-interacting protein...		Potri.004G111350 [exp]	13.63	0.9468
AT1G79915			Putative methyltransferase fam...		Potri.001G181200 [exp]	15.58	0.8703
AT1G43790		TED6	tracheary element differentiat...		Potri.002G072000 [exp]	17.54	0.8764
AT2G27930			PLATZ transcription factor fam...		Potri.009G003200 [exp]	19.69	0.8563
AT5G20940			Glycosyl hydrolase family prot...		Potri.009G154032 [exp]	21.00	0.9464
AT2G31690			alpha/beta-Hydrolases superfam...		Potri.014G150700 [exp]	25.03	0.9447

Compare expression of checked genes

Potri.014G067500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.