Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68840 47 / 4e-07 AP2_ERF EDF2, RAV2, RAP2.8, TEM2, AtRAV2 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2) AT2G36080 43 / 6e-06 B3 ABS2, NGAL1 AP2/B3-like transcriptional factor family protein (.1.2) AT3G11580 42 / 1e-05 B3 AP2/B3-like transcriptional factor family protein (.1.2) AT2G30470 40 / 0.0001 B3 HSI2, VAL1 VP1/ABI3-LIKE 1, high-level expression of sugar-inducible gene 2 (.1) AT1G77850 38 / 0.0005 ARF ARF17 auxin response factor 17 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G067900 [exp] 157 / 4e-51 AT4G01500 42 / 2e-05 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015650 [exp] 134 / 5e-42 AT1G13260 50 / 6e-08 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.015G015800 [exp] 132 / 6e-41 AT1G13260 44 / 7e-06 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.012G013167 [exp] 128 / 1e-39 AT1G43950 49 / 1e-07 auxin response factor 23 (.1) Potri.015G015501 [exp] 127 / 3e-39 AT1G13260 46 / 1e-06 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.015G015275 [exp] 127 / 4e-39 AT4G01500 44 / 4e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G013700 [exp] 127 / 5e-39 AT4G01500 52 / 6e-09 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G012950 [exp] 126 / 7e-39 AT1G35520 49 / 9e-08 auxin response factor 15 (.1) Potri.012G012850 [exp] 125 / 3e-38 AT4G01500 49 / 6e-08 NGATHA4, AP2/B3-like transcriptional factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011245 [exp] 44 / 1e-05 AT2G30470 399 / 1e-122 VP1/ABI3-LIKE 1, high-level expression of sugar-inducible gene 2 (.1) Lus10018440 [exp] 43 / 1e-05 AT4G32010 487 / 1e-158 VP1/ABI3-LIKE 2, HSI2-like 1 (.1) Lus10041340 [exp] 43 / 1e-05 AT3G61830 370 / 2e-122 auxin response factor 18 (.1) Lus10030240 [exp] 42 / 3e-05 AT2G46530 381 / 1e-126 auxin response factor 11 (.1.2.3) Lus10025226 [exp] 40 / 0.0001 AT4G32010 808 / 0.0 VP1/ABI3-LIKE 2, HSI2-like 1 (.1) Lus10022741 [exp] 38 / 0.0007 AT4G32010 748 / 0.0 VP1/ABI3-LIKE 2, HSI2-like 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.014G068000.1 pacid=42764639 polypeptide=Potri.014G068000.1.p locus=Potri.014G068000 ID=Potri.014G068000.1.v4.1 annot-version=v4.1 ATGGCAATCTTTTCCAAGTCACTAACCAAGACCGACATTGAGAAAAGATTGTCATTTCCAACCAAGTGTCTCAGGTCCTTGCCATGCTTTGGGAGAGGCC ATGCAGTGGATTTTCACGTAATGGATGAGTGTGGGCAAGTCTGGACTTTCCGCTGCACCATTCGCAAAAAGAACCATCCGAAACCTGTTATCTCTAAGGA TTGGAGCAAATTTGTTTCCAGCAAACATCTCGATGTTGGTGATAAAATCACTTTCTCTAAGCTTGAAAATAAAGTTAGCTGTGCTTTTTACAAGATTGAG GTGAAGAAGCCGGTCAAGCTATTCGGGGTAAATGTGGGTTACTAA
AA sequence Show only first row Show all	>Potri.014G068000.1 pacid=42764639 polypeptide=Potri.014G068000.1.p locus=Potri.014G068000 ID=Potri.014G068000.1.v4.1 annot-version=v4.1 MAIFSKSLTKTDIEKRLSFPTKCLRSLPCFGRGHAVDFHVMDECGQVWTFRCTIRKKNHPKPVISKDWSKFVSSKHLDVGDKITFSKLENKVSCAFYKIE VKKPVKLFGVNVGY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G68840	AP2_ERF	EDF2, RAV2, RAP...	TEMPRANILLO 2, RELATED TO AP2 ...		Potri.014G068000 [exp]	0	1
					Potri.006G031300 [exp]	3.16	0.9358
AT2G45280		ATRAD51C	RAS associated with diabetes p...		Potri.014G068100 [exp]	3.87	0.7381	Pt-RAD51.1
AT3G57770			Protein kinase superfamily pro...		Potri.005G106600 [exp]	5.00	0.9310
AT1G51400			Photosystem II 5 kD protein (....		Potri.009G052500 [exp]	6.48	0.8635
AT1G74000		SS3	strictosidine synthase 3 (.1)		Potri.015G037700 [exp]	6.92	0.8185
AT1G65790		ARK1	receptor kinase 1 (.1)		Potri.004G024316 [exp]	7.74	0.7983
AT1G01710			Acyl-CoA thioesterase family p...		Potri.002G159150 [exp]	8.12	0.7851
AT4G36600			Late embryogenesis abundant (L...		Potri.005G122400 [exp]	11.95	0.7526
AT1G01490			Heavy metal transport/detoxifi...		Potri.018G148900 [exp]	12.00	0.6710
					Potri.002G118950 [exp]	12.96	0.6898

Compare expression of checked genes

Potri.014G068000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.