RPS13.1 (Potri.014G068600) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol RPS13.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60770 291 / 4e-103 Ribosomal protein S13/S15 (.1)
AT4G00100 288 / 6e-102 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G146800 302 / 2e-107 AT3G60770 287 / 1e-101 Ribosomal protein S13/S15 (.1)
Potri.012G128600 296 / 6e-105 AT4G00100 288 / 6e-102 POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
Potri.015G130000 295 / 1e-104 AT4G00100 283 / 7e-100 POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038908 290 / 3e-102 AT4G00100 289 / 4e-102 POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
Lus10027192 290 / 3e-102 AT4G00100 289 / 4e-102 POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
Lus10031704 268 / 6e-94 AT4G00100 267 / 9e-94 POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
Lus10031124 268 / 6e-94 AT4G00100 267 / 9e-94 POINTED FIRST LEAF 2, ribosomal protein S13A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0600 S15_NS1 PF00312 Ribosomal_S15 Ribosomal protein S15
CL0600 PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Representative CDS sequence
>Potri.014G068600.1 pacid=42764064 polypeptide=Potri.014G068600.1.p locus=Potri.014G068600 ID=Potri.014G068600.1.v4.1 annot-version=v4.1
ATGGGTCGTATGCACAGTAAAGGCAAGGGTATCTCAGCATCTGCTTTGCCATACAAGAGGACCTCACCTAGTTGGCTCAAGATTTCTCCTCAAGATGTTG
ACGACAATATCTGCAAGTTTGCAAAGAAAGGTTTGACACCATCTCAAATTGGTGTTATCCTTCGTGATTCTCATGGTATTGCTCAAGTGAAGACTGTTAC
TGGCAACCAGATTTTGAGGATATTGAAGGCCCATGGGCTTGCACCTGAAATTCCTGAGGATCTGTACCACCTCATTAAGAAAGCAGTTGCTATTAGGAAG
CATCTAGAGAGGAACAGGAAGGATAAAGATTCCAAATTTAGGTTGATTTTGGTCGAGAGCAGGATCCACCGCCTTGCTCGCTATTACAAGAAGACCAAGA
AGCTTCCACCAGTCTGGAAATATGAATCCACCACTGCCAGCACTCTCGTGGCATAG
AA sequence
>Potri.014G068600.1 pacid=42764064 polypeptide=Potri.014G068600.1.p locus=Potri.014G068600 ID=Potri.014G068600.1.v4.1 annot-version=v4.1
MGRMHSKGKGISASALPYKRTSPSWLKISPQDVDDNICKFAKKGLTPSQIGVILRDSHGIAQVKTVTGNQILRILKAHGLAPEIPEDLYHLIKKAVAIRK
HLERNRKDKDSKFRLILVESRIHRLARYYKKTKKLPPVWKYESTTASTLVA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G60770 Ribosomal protein S13/S15 (.1) Potri.014G068600 0 1 RPS13.1
AT4G09800 RPS18C S18 ribosomal protein (.1) Potri.002G051300 2.00 0.9589
AT4G25740 RNA binding Plectin/S10 domain... Potri.017G146700 4.24 0.9556 RPS10.3
AT2G18110 Translation elongation factor... Potri.015G094200 7.93 0.9406 Pt-EEF1.1
AT4G09800 RPS18C S18 ribosomal protein (.1) Potri.005G211200 8.60 0.9567
AT3G07910 unknown protein Potri.003G197801 9.94 0.9093
AT2G19730 Ribosomal L28e protein family ... Potri.003G045500 10.48 0.9544
AT1G57860 Translation protein SH3-like f... Potri.016G061100 10.95 0.9490
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Potri.007G096300 10.95 0.9444
AT5G35530 Ribosomal protein S3 family pr... Potri.006G222100 11.48 0.9552
AT5G02610 Ribosomal L29 family protein ... Potri.008G048800 11.48 0.9536 RPL35.1

Potri.014G068600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.