Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PBF1.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60820 363 / 5e-129 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT1G21720 82 / 4e-19 PBC1 proteasome beta subunit C1 (.1) AT1G77440 80 / 2e-18 PBC2 20S proteasome beta subunit C2 (.1.2) AT4G31300 61 / 5e-11 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G148300 [exp] 431 / 4e-156 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.002G080800 [exp] 86 / 9e-21 AT1G21720 383 / 1e-137 proteasome beta subunit C1 (.1) Potri.005G180500 [exp] 86 / 2e-20 AT1G21720 391 / 9e-141 proteasome beta subunit C1 (.1) Potri.006G077900 [exp] 66 / 8e-13 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.008G155500 [exp] 51 / 8e-08 AT3G22630 364 / 6e-130 20S proteasome beta subunit D1 (.1) Potri.010G084800 [exp] 50 / 3e-07 AT3G22630 366 / 6e-131 20S proteasome beta subunit D1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015867 [exp] 371 / 4e-132 AT3G60820 379 / 2e-135 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10009294 [exp] 309 / 6e-100 AT1G48050 835 / 0.0 ARABIDOPSIS THALIANA KU80 HOMOLOG, Ku80 family protein (.1) Lus10000062 [exp] 220 / 9e-74 AT3G60820 232 / 6e-79 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10004024 [exp] 171 / 2e-53 AT3G60820 190 / 4e-61 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10030271 [exp] 85 / 1e-21 AT3G60820 82 / 3e-21 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10030272 [exp] 83 / 7e-21 AT3G60820 81 / 2e-20 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10020599 [exp] 70 / 1e-14 AT1G21720 355 / 7e-127 proteasome beta subunit C1 (.1) Lus10004885 [exp] 69 / 3e-14 AT1G21720 356 / 2e-127 proteasome beta subunit C1 (.1) Lus10020180 [exp] 59 / 3e-10 AT4G31300 429 / 7e-155 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10041194 [exp] 54 / 8e-09 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [poplar] [flax] NTN PF00227 [poplar] [flax] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Potri.014G069800.2 pacid=42763610 polypeptide=Potri.014G069800.2.p locus=Potri.014G069800 ID=Potri.014G069800.2.v4.1 annot-version=v4.1 ATGACTAAGCAACAAGCAAGATTTGAACCCTACGATTTTAATGGAGGGACTTGTGTTGCGATTGCTGGAGCTGATTACTGTGTTGTCGCTGCTGATACTC GAATGTCTACCGGATACAATATCCTCACTCGCGATTACTCCAAAATCTGTAAACTAGCAGACAAATGTTTGATGGCCTCTTCAGGGTTTCAAGCTGATGT CAAAGCCCTACAAAAGGTGTTGGGTGCCAAGCACCTGATCTATCAACATCAACACAACAAGCAGATGAGCTGCCCTGCCATGGCTCGACTGCTCTCCAAC ACTCTCTACTACAAACGTTTCTTCCCTTATTATACCTTCAATGTTTTGGTTGGCTTTGACGAGGAAGGAAAGGGCTGTGTTTACACTTATGATGCTGTTG GTTCCTATGAGAAGGTTGGGTATAGTGCCCAAGGTTCTGGTGCTAAACTCATCATGCCTGTGCTGGATAACCAATTGAAGTCCCCCAGCCCGCTTTTATT ACCTGCTCTGGATGCTGTAACTCCACTTACTGAGGCAGAAGCGATTGATGTGGTCAAAGATGTTTTTGCATCTGCAACTGAGAGGGATATATACACTGGA GACAAACTTGAAATTGTCATCGTAAATGCTGATGGTATTCGTCGTGAATACGCGGAACTCAGAAAAGATTGA
AA sequence Show only first row Show all	>Potri.014G069800.2 pacid=42763610 polypeptide=Potri.014G069800.2.p locus=Potri.014G069800 ID=Potri.014G069800.2.v4.1 annot-version=v4.1 MTKQQARFEPYDFNGGTCVAIAGADYCVVAADTRMSTGYNILTRDYSKICKLADKCLMASSGFQADVKALQKVLGAKHLIYQHQHNKQMSCPAMARLLSN TLYYKRFFPYYTFNVLVGFDEEGKGCVYTYDAVGSYEKVGYSAQGSGAKLIMPVLDNQLKSPSPLLLPALDAVTPLTEAEAIDVVKDVFASATERDIYTG DKLEIVIVNADGIRREYAELRKD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G60820		PBF1	N-terminal nucleophile aminohy...		Potri.014G069800 [exp]	0	1	PBF1.2
AT1G16470		PAB1	proteasome subunit PAB1 (.1.2)		Potri.015G122400 [exp]	1.00	0.9511
AT1G47640			unknown protein		Potri.002G130100 [exp]	2.82	0.9179
AT3G14290		PAE2	20S proteasome alpha subunit E...		Potri.001G162900 [exp]	2.82	0.9362	Pt-PAE1.1
AT1G64520		RPN12A	regulatory particle non-ATPase...		Potri.003G142700 [exp]	3.00	0.9051
AT1G09150			pseudouridine synthase and arc...		Potri.005G023600 [exp]	4.24	0.9316
AT1G45000			AAA-type ATPase family protein...		Potri.005G231700 [exp]	6.32	0.9247	RPT4.1
AT1G64520		RPN12A	regulatory particle non-ATPase...		Potri.001G088200 [exp]	6.32	0.9227
AT5G20570		HRT1, ROC1, RBX...	REGULATOR OF CULLINS-1, RING-b...		Potri.006G141300 [exp]	6.48	0.8688
AT5G19990		ATSUG1, RPT6A	regulatory particle triple-A A...		Potri.008G144100 [exp]	6.70	0.8928	A1.3
AT5G23540			Mov34/MPN/PAD-1 family protein...		Potri.002G127900 [exp]	7.14	0.8916

Compare expression of checked genes

Potri.014G069800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.